SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for ENSGGOP00000004604 from Gorilla gorilla 76_3.1

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSGGOP00000004604
Domain Number 1 Region: 368-420
Classification Level Classification E-value
Superfamily beta-beta-alpha zinc fingers 0.000000000000121
Family Classic zinc finger, C2H2 0.0065
Further Details:      
 
Domain Number 2 Region: 812-863
Classification Level Classification E-value
Superfamily beta-beta-alpha zinc fingers 0.00000000000736
Family Classic zinc finger, C2H2 0.01
Further Details:      
 
Domain Number 3 Region: 1011-1061
Classification Level Classification E-value
Superfamily beta-beta-alpha zinc fingers 0.0000136
Family Classic zinc finger, C2H2 0.019
Further Details:      
 
Domain Number 4 Region: 329-338
Classification Level Classification E-value
Superfamily Formin homology 2 domain (FH2 domain) 0.0000759
Family Formin homology 2 domain (FH2 domain) 0.13
Further Details:      
 
Weak hits

Sequence:  ENSGGOP00000004604
Domain Number - Region: 428-452
Classification Level Classification E-value
Superfamily beta-beta-alpha zinc fingers 0.00717
Family Classic zinc finger, C2H2 0.014
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Molecular Function IC (bits) H-Score
Biological Process IC (bits) H-Score
Cellular Component IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSGGOP00000004604   Gene: ENSGGOG00000004696   Transcript: ENSGGOT00000004724
Sequence length 1077
Comment pep:known_by_projection chromosome:gorGor3.1:4:155932036:156084652:-1 gene:ENSGGOG00000004696 transcript:ENSGGOT00000004724 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
PSRQKKKKKKLTSDVSRQEEAEGELSEGEHWYGNSSETPSEASYGEVQENYKLSLEDRIQ
EQSTSPDTSLGSTTPSSHTLELVALDSEVLRDSLQCQDHLSPGVSSLCDDDPGSNKPLSS
NLRRLLEAGSLKLDAAATANGRMESPVNVGSNLSFSPPSHHAQQLSVLARKLAEKQEQND
QYTPSNRFIWNQGKWLPNSTTTCSLSPDSAILKLKAAANAVLQDKSLTRTEETMRFESFS
SPFSSQSASSTLAALSKKVSERSLTPGQEHPPPASSFLSLASMTSSAALLKEVAARAAGS
LLAEKSSLLPEDPLPPPPSEKKPEKVTPPPPPPPPPPPPQSLELLLLPVPKGRVSKPSNS
ASEEESGKPFQCPICGLVIKRKSYWKRHMVIHTGLKSHQCPLCPFRCARKDNLKSHMKVH
QHQDRGETFQCQLCPFTSSRHFSLKLHMRCHQHFLRTEAKVKEEIPDPDVKGSPHLSDSA
CLGQQREGGGTELVGTMMTSNTPERTSQGGAGVSPLLVKEEPKEDNGLPTSFTLNAADRP
ANHTKLKDPSEYVANSASALFSQDISVKMASDFLMKLSAANQKEPMNLNFKVKEEPKEGE
SLSTTLPRSSYVFSPESEVSAPGVSEDALKPQEGKGSVLRRDVSVKAASELLMKLSAESY
KETQMVKIKEEPMEVDIQDSHVSISPSRNVGYSTLIGREKTEPLQKMPEGRVPPERNLFS
QDISVKMASELLFQLSEKVSKEHNHTKENTIRTTTSPFFSEDTFRQSPFTSNSKELLPSD
SVLHGRISAPETEKIVLEAGNGLPSWKFNDQLFPCDVCGKVFGRQQTLSRHLSLHTEERK
YKCHLCPYAAKCRANLNQHLTVHSVKLVSTDTEDIVSAVTSEGSDGKKHPYYYSCHVCGF
ETELNVQFVSHMSLHVDKEQWMFSICCTACDFVTMEEAEIKTHIGTKHTGEDRKTPSESN
SPSSSSLSALSDSANSKDDSDGSQKNKGGNNLLVISVMPGSQPSLNSEEKPEKGFECVFC
NFVCKTKNMFERHLQIHLITRMFECDVCHKFMKTPEQLLEHKKCHTVPTGGLNSGQW
Download sequence
Identical sequences ENSGGOP00000004604

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]