SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for ENSGGOP00000004631 from Gorilla gorilla 76_3.1

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSGGOP00000004631
Domain Number 1 Region: 471-533
Classification Level Classification E-value
Superfamily C-type lectin-like 0.0000000000000167
Family C-type lectin domain 0.014
Further Details:      
 
Weak hits

Sequence:  ENSGGOP00000004631
Domain Number - Region: 124-293
Classification Level Classification E-value
Superfamily Tropomyosin 0.000305
Family Tropomyosin 0.016
Further Details:      
 
Domain Number - Region: 331-428
Classification Level Classification E-value
Superfamily Tropomyosin 0.015
Family Tropomyosin 0.0081
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Cellular Component IC (bits) H-Score
Molecular Function IC (bits) H-Score
Biological Process IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSGGOP00000004631   Gene: ENSGGOG00000004728   Transcript: ENSGGOT00000004751
Sequence length 589
Comment pep:known_by_projection chromosome:gorGor3.1:2a:72131165:72140957:-1 gene:ENSGGOG00000004728 transcript:ENSGGOT00000004751 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
MDGEAVRFCTDNQCVSLHPQEVDSVATAPAAPKIPRLVQATPAFMAVTLVFSLVTLFVVV
QQHTRPVLKPVQAVILGDNITGHLPFEPNNHHHFGREAEMRELIQTFKGHMENSSAWVVE
IQMLKCRVDNVNSQLQVLGDHLGNTSADIQMVKGVLKDATTLSLQTQMLRSSLEGTHAEI
QRLKGDLEKADALTFQMLNFLKSSLENTSIELHVLSRGLENANSEIQLLNASLETANTQA
QLANSSLKNANAEIHVLRGHLDSVNDLRTQNQVLRNSLEGANAEIQGLKENLQNTNALNS
QTQAFIKSSFDNSSAEIQFLRGHLERAGDDIHVLKRDLEMVTAQTQKANGRLDQTDTQIQ
VFKAGMENANTLNAQIQVLNGHMKNASREIQTLKQGMKNASALTSQTQMLDSNLQKASAE
IRRLRGDLENTRALTMEIQQEQSHLKTLHEVVISQEELQRTQSQLLQMVLQGWKFNGGSL
YYFSSVKKSWHEAEQFCVSQGAHLASVASKEEQVRAASMECCWWNWCGIRDFGVLAFLLS
AGMTDFFPPALLRPGSKGSCPLRRYISVNSGVGACSFIDTPPCPWILSN
Download sequence
Identical sequences ENSGGOP00000004631 ENSGGOP00000004631

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]