SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for ENSGGOP00000004635 from Gorilla gorilla 76_3.1

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSGGOP00000004635
Domain Number 1 Region: 193-323
Classification Level Classification E-value
Superfamily C-type lectin-like 3.15e-41
Family C-type lectin domain 0.00027
Further Details:      
 
Weak hits

Sequence:  ENSGGOP00000004635
Domain Number - Region: 79-206
Classification Level Classification E-value
Superfamily Bacterial hemolysins 0.00259
Family HBL-like 0.021
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Cellular Component IC (bits) H-Score
Biological Process IC (bits) H-Score
Molecular Function IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSGGOP00000004635   Gene: ENSGGOG00000004733   Transcript: ENSGGOT00000004755
Sequence length 328
Comment pep:known_by_projection chromosome:gorGor3.1:2a:72150586:72156189:-1 gene:ENSGGOG00000004733 transcript:ENSGGOT00000004755 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
MTVEREAPDAHFTVDKQNISLWPREPPPKSGPSLVPGKTPTVRAALICLTLVLVASVLLQ
AILYPRFMGTISDVKTNVQLLKGRVDNISTLDSEIKKNSDGMEAAGVQIQMVNVSLGYVR
SQFLKLKTSVEKANAQIQILTRSWEEVSTLNAQIPELKSDLEKASALNTKIRALQGSLEN
MSKLLKRQNDILQVVSQGWKYFKGNFYYFSLIPKTWYSAEQFCVSRNSHLTSVTSESEQE
FLYKTAGGLIYWIGLTKAGMEGDWSWVDDTPFNKVQSARFWIPGEPNNAGNNEHCGNIKA
PSLQAWNDAPCDKTFLFICKRPYVPSEP
Download sequence
Identical sequences G3QPX8
ENSGGOP00000004635 XP_004029431.1.27298 ENSGGOP00000004635

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]