SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for ENSGGOP00000004656 from Gorilla gorilla 76_3.1

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSGGOP00000004656
Domain Number 1 Region: 441-677,737-810
Classification Level Classification E-value
Superfamily (Phosphotyrosine protein) phosphatases II 8.55e-38
Family Myo-inositol hexaphosphate phosphohydrolase (phytase) PhyA 0.063
Further Details:      
 
Domain Number 2 Region: 55-333
Classification Level Classification E-value
Superfamily (Phosphotyrosine protein) phosphatases II 6.04e-29
Family Higher-molecular-weight phosphotyrosine protein phosphatases 0.074
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Cellular Component IC (bits) H-Score
Biological Process IC (bits) H-Score
Molecular Function IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSGGOP00000004656   Gene: ENSGGOG00000004747   Transcript: ENSGGOT00000004775
Sequence length 856
Comment pep:known_by_projection chromosome:gorGor3.1:10:82977508:83073883:1 gene:ENSGGOG00000004747 transcript:ENSGGOT00000004775 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
MGTTASTAQQTVSAGTPFEGLQGSGTMDNRHSVSIHSFQTTSLHNSKAKSIIPNKVAPVV
ITYNCKEEFQIHDELLKAHYTLGRLSDTTPEHYLVQGRYFLVRDVTEKMDVLGTVGSCGA
PNFRQVQGGLTVFGMGQPSLSGFRRVLQKLQKDGHRECVIFCVREEPVLFLRADEDFVSY
TPRDKQNLHENLQGLGPGVRVESLELAIRKEIHDFAQLSENTYHVYHNTEDLRGEPHAVA
IRGEDDLHVTEEVYKRPLFLQPTYRYHRLPLPEQGSPLETQLDAFVSVLRETPSLLQLRD
AHGPPPALVFSCQMGVGRTNLGMVLGTLILLHRSGTTSQPEAAPTQAKPLPMEQFQVIQS
FLRMVPQGRRMVEEVDRAITACAELHDLKEVVLENQKKLEGIRLESPAQGSGSQHSIWQR
ALRSLERYFYLILFNYYLHEQYPLAFALSFSRWLCAHPELYRLPVTLSSAGPVAPRDLIA
RGSLREDDLVSPDALSTVREMDVANFRRVPRMPIYGTAQPSAKALGSILAYLTDAKRRLR
KVVWVSLREEAVLECDGHTHSLRWPGPPVAPNQLETLEAQLKAHLSEPPPGKEGPPTYRF
QTCLTMQEIFSQHRRACPGLTYHRIPMPDFCAPREEDFDQLLEALRAALSKDPGTGFVFS
CLSGQGRTTTAMVVAVLAFWHIQGFPEVGEEELVSVPDAKFTKGEFQVVMKVVQLLPDGH
RVKKEVDAALDTVSETMTPMHYHLREIIICTYRQAKAAKEAQEMRSLQLRSLQYLERYVC
LILFNAYLHLEKADSWQRPFSTWMQEVASKAGIYEILNELGFPELESGEDQPFSRLRYRW
QEQSCSLEPSAPEDLL
Download sequence
Identical sequences ENSGGOP00000004656 ENSGGOP00000004656

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]