SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for ENSGGOP00000004658 from Gorilla gorilla 76_3.1

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSGGOP00000004658
Domain Number 1 Region: 178-369
Classification Level Classification E-value
Superfamily 6-phosphogluconate dehydrogenase C-terminal domain-like 6.8e-88
Family Hydroxyisobutyrate and 6-phosphogluconate dehydrogenase domain 0.0000000113
Further Details:      
 
Domain Number 2 Region: 4-175
Classification Level Classification E-value
Superfamily NAD(P)-binding Rossmann-fold domains 1.28e-53
Family 6-phosphogluconate dehydrogenase-like, N-terminal domain 0.0000000444
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Biological Process IC (bits) H-Score
Molecular Function IC (bits) H-Score
Cellular Component IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSGGOP00000004658   Gene: ENSGGOG00000004754   Transcript: ENSGGOT00000004778
Sequence length 369
Comment pep:known_by_projection chromosome:gorGor3.1:1:10595488:10613431:1 gene:ENSGGOG00000004754 transcript:ENSGGOT00000004778 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
MAQADIALIGLAVMGQNLILNMNDHGFVVCAFNRTVSKVDDFLANEAKGTKVVGAQSLKE
MVSKLKKPRRIILLVKAGQAVDDFIEKLVPLLDTGDIIIDGGNSEYRDTTRRCRDLKAKG
ILFVGSGVSGGEEGARYGPSLMPGGNKEAWPHIKTIFQGIAAKVGTGEPCCDWVGDEGAG
HFVKMVHNGIEYGDMQLICEAYHLMKDVLGMAQDEMSQAFEDWNKTELDSFLIEITANIL
KFQDTDGKHLLPKIRDSAGQKGTGKWTAISALEYGVPVTLIGEAVFARCLSSLKDERIQA
SKKLKGPQKFQFDGDKKSFLEDIRKALYASKIISYAQGFMLLRQAATEFGWTLNYGGIAL
MWRGGCIIR
Download sequence
Identical sequences ENSGGOP00000004658 ENSGGOP00000004658

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]