SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for ENSGGOP00000004659 from Gorilla gorilla 76_3.1

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSGGOP00000004659
Domain Number 1 Region: 85-353
Classification Level Classification E-value
Superfamily Cysteine proteinases 2.75e-71
Family Ubiquitin carboxyl-terminal hydrolase, UCH 0.000034
Further Details:      
 
Domain Number 2 Region: 412-482
Classification Level Classification E-value
Superfamily DUSP-like 0.0000000000863
Family DUSP, domain in ubiquitin-specific proteases 0.012
Further Details:      
 
Domain Number 3 Region: 875-930
Classification Level Classification E-value
Superfamily Ubiquitin-like 0.0000000361
Family Ubiquitin-related 0.0085
Further Details:      
 
Weak hits

Sequence:  ENSGGOP00000004659
Domain Number - Region: 665-739
Classification Level Classification E-value
Superfamily DUSP-like 0.00262
Family DUSP, domain in ubiquitin-specific proteases 0.011
Further Details:      
 
Domain Number - Region: 575-615
Classification Level Classification E-value
Superfamily DUSP-like 0.0129
Family DUSP, domain in ubiquitin-specific proteases 0.016
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Biological Process IC (bits) H-Score
Cellular Component IC (bits) H-Score
Molecular Function IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSGGOP00000004659   Gene: ENSGGOG00000004749   Transcript: ENSGGOT00000004779
Sequence length 963
Comment pep:known_by_projection chromosome:gorGor3.1:1:22390771:22495402:-1 gene:ENSGGOG00000004749 transcript:ENSGGOT00000004779 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
MAPRLQLEKAAWRWAETVRPEEVSQEHIETAYRIWLEPCIRGVCRRNCKGNPNCLVGIGE
HIWLGEIDENSFHNIDDPNCERRKKNSFVGLTNLGATCYVNTFLQVWFLNLELRQALYLC
PSTCSDYMLGDGIQEEKDYEPQTICEHLQYLFALLQNSNRRYIDPSGFVKALGLDTGQQQ
DAQEFSKLFMSLLEDTLSKQKNPDVRNIVQQQFCGEYAYVTVCNQCGRESKLLSKFYELE
LNIQGHKQLTDCISEFLKEEKLEGDNRYFCENCQSKQNATRKIRLLSLPCTLNLQLMRFV
FDGSYVYELSAVLIHRGVSAYSGHYIAHVKDPQSGEWYKFNDEDIEKMEGKKLQLGIEED
LAFLQELVDRDNSKFEEWCIEMAEMRKQSVDKGKAKHEEVKELYQRLPAGAEPYEFVSLE
WLQKWLDESTPTKPIDNHACLCSHDKLHPDKISIMKRISEYAADIFYSRYGGGPRLTVKA
LCKECVVERCRILRLKNQLNEDYKTVNNLLKAAVKGNDGFWVGKSSLRSWRQLALEQLDE
QDGDAEQSNGKMNGSTLNKDESKEERKEEEELNFNEDILCPHGELCISENERRLVSKEAW
SKLQQYFPKAPEFPSYKECCSQCKILEREGEENEALHKMIANEQKTSLPNLFQDKNRPCL
SNWPEDTDVLYIVSQFFVEEWRKFVRKPTRCSPVSSVGNSALLCPHGGLMFTFASMTKED
SKLIALIWPSEWQMIQKLFVVDHVIKITRIEVGDVNPSETQYISEPKLCPECREGLLCQQ
QRDLREYTQATIYVHKVVDNKKVMKDSAPELNVSSSETEEDKEEAKPDGEKDPDFNQSNG
GTKRQKISHQNYIAYQKQVIRRSMRHRKVRGEKALLVSANQTLKELKIQIMHAFSVAPFD
QNLSIDGKILSDDCATLGTLGVIPESVILLKADEPIADYAAMDDVMQVCMPEEGFKGTGL
LGH
Download sequence
Identical sequences ENSGGOP00000004659

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]