SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for ENSGGOP00000004706 from Gorilla gorilla 76_3.1

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSGGOP00000004706
Domain Number 1 Region: 10-189
Classification Level Classification E-value
Superfamily EF-hand 7.05e-31
Family Calmodulin-like 0.0000000297
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Molecular Function IC (bits) H-Score
Cellular Component IC (bits) H-Score
Biological Process IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSGGOP00000004706   Gene: ENSGGOG00000004802   Transcript: ENSGGOT00000004826
Sequence length 191
Comment pep:known_by_projection chromosome:gorGor3.1:15:70051206:70055834:-1 gene:ENSGGOG00000004802 transcript:ENSGGOT00000004826 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
MGGSGSRLSKELLAEYQDLTFLTKQEILLAHRRFCELLPQEQRSVESSLRAQVPFEQILS
LPELKANPFKERICRVFSTSPAKDSLSFEDFLDLLSVFSDTATPDIKSHYAFRIFDFDDD
GTLNREDLSRLVNCLTGEGEDTRLSASEMKQLIDNILEESDIDRDGTINLSEFQHVISRS
PDFASSFKIVL
Download sequence
Identical sequences A0A140VK09 G3QQ48 K6ZLP5 Q99828
9598.ENSPTRP00000012735 9606.ENSP00000333873 ENSPTRP00000012735 NP_006375.2.87134 NP_006375.2.92137 XP_003807774.1.60992 XP_004056809.1.27298 XP_510591.2.37143 ENSGGOP00000004706 ENSP00000333873 ENSGGOP00000004706 ENSP00000333873 ENSPTRP00000012735 gi|163644313|ref|NP_006375.2| ENSP00000333873

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]