SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for ENSGGOP00000004709 from Gorilla gorilla 76_3.1

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSGGOP00000004709
Domain Number 1 Region: 45-622
Classification Level Classification E-value
Superfamily ARM repeat 3.74e-108
Family Clathrin adaptor core protein 0.000000685
Further Details:      
 
Domain Number 2 Region: 718-844
Classification Level Classification E-value
Superfamily Clathrin adaptor appendage domain 4.19e-43
Family gamma-adaptin C-terminal appendage domain-like 0.000000514
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Molecular Function IC (bits) H-Score
Cellular Component IC (bits) H-Score
Biological Process IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSGGOP00000004709   Gene: ENSGGOG00000004800   Transcript: ENSGGOT00000004830
Sequence length 845
Comment pep:known_by_projection chromosome:gorGor3.1:16:61986620:62065465:-1 gene:ENSGGOG00000004800 transcript:ENSGGOT00000004830 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
MEKNINLRNCQTLNTYVMLTHLRMPAPIRLRELIRTIRTARTQAEEREMIQKECAAIRSS
FREEDNTYRCRNVAKLLYMHMLGYPAHFGQLECLKLIASQKFTDKRIGYLGAMLLLDERQ
DVHLLMTNCIKNDLNHSTQFVQGLALCTLGCMGSSEMCRDLAGEVEKLLKTSNSYLRKKA
ALCAVHVIRKVPELMEMFLPATKNLLNEKNHGVLHTSVVLLTEMCERSPDMLAHFRKLVP
QLVRILKNLIMSGYSPEHDVSGISDPFLQVRILRLLRILGRNDDDSSEAMNDILAQVATN
TETSKNVGNAILYETVLTIMDIKSESGLRVLAINILGRFLLNNDKNIRYVALTSLLKTVQ
TDHNAVQRHRSTIVDCLKDLDVSIKRRAMELSFALVNGNNIRGMMKELLYFLDSCEPEFK
ADCASGIFLAAEKYAPSKRWHIDTIMRVLTTAGSYVRDDAVPNLIQLITNSVEMHAYTVQ
RLYKAILGDYSQQPLVQVAAWCIGEYGDLLVSGQCEEEEPIQVTEDEVLDILESVLISNM
STSVTRGYALTAIMKLSTRFTCTVNRIKKVVSIYGSSIDVELQQRAVEYNALFKKYDHMR
SALLERMPVMEKVTTNGPTEIVQTNGETEPAPLETKPPPSGPQPTSQANDLLDLLGGNDI
TPVIPTAPTSKPSSAGGELLDLLGDINLTGAPAAAPAPASVPQISQPPFLLDGLSSQPLF
NDIAAGIPSITAYSKNGLKIEFTFERSNTNPSVTVITIQASNSTELDMTDFVFQAAVPKT
FQLQLLSPSSSIVPAFNTGTITQVIKVLNPQKQQLRMRIKLTYNHKGSAMQDLAEVNNFP
PQSWQ
Download sequence
Identical sequences B3KXW5
ENSGGOP00000004709 ENSGGOP00000004709 ENSP00000299980 ENSPTRP00000014227 ENSPTRP00000014227 ENSP00000403259

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]