SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for ENSGGOP00000004729 from Gorilla gorilla 76_3.1

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSGGOP00000004729
Domain Number 1 Region: 387-619
Classification Level Classification E-value
Superfamily Voltage-gated potassium channels 7.3e-36
Family Voltage-gated potassium channels 0.012
Further Details:      
 
Domain Number 2 Region: 1048-1206,1243-1320
Classification Level Classification E-value
Superfamily Voltage-gated potassium channels 2.59e-32
Family Voltage-gated potassium channels 0.027
Further Details:      
 
Domain Number 3 Region: 1369-1611
Classification Level Classification E-value
Superfamily Voltage-gated potassium channels 2.75e-32
Family Voltage-gated potassium channels 0.022
Further Details:      
 
Domain Number 4 Region: 2-153,198-268
Classification Level Classification E-value
Superfamily Voltage-gated potassium channels 5.57e-31
Family Voltage-gated potassium channels 0.021
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Cellular Component IC (bits) H-Score
Molecular Function IC (bits) H-Score
Biological Process IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSGGOP00000004729   Gene: ENSGGOG00000004807   Transcript: ENSGGOT00000004851
Sequence length 2207
Comment pep:known_by_projection chromosome:gorGor3.1:9:121544639:121792339:1 gene:ENSGGOG00000004807 transcript:ENSGGOT00000004851 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
PFEYMILATIIANCIVLALEQHLPDGDKTPMSERLDDTEPYFIGIFCFEAGIKIIALGFV
FHKGSYLRNGWNVMDFVVVLTGILATAGTDFDLRTLRAVRVLRPLKLVSGIPSLQVVLKS
IMKAMVPLLQIGLLLFFAILMFAIIGLEFYMGKFHKACFPNSTDAEPVGDFPCGKEAPAR
LCEGDTECREYWPGPNFGITNFDNILFAILTVFQCITMEGWTDILYNTNDAAGNTWNWLY
FIPLIIIGSFFMLNLVLGVLSGEFAKERERVENRRAFLKLRRQQQIERELNGYLEWIFKA
EEVMLAEEDRNAEEKSPLDAVLKRAATKKSRNDLIHAEEGEDRFADLCAVGSPFARASLK
SGKTESSSYFRRKEKMFRFFIRRMVKAQSFYWVVLCVVALNTLCVAMVHYNQPRRLTTAL
YFAEFVFLGLFLTEMSLKMYGLGPRSYFRSSFNCFDFGVIVGSVFEVVWAAIKPGSSFGI
SVLRALRLLRIFKVTKYWSSLRNLVVSLLNSMKSIISLLFLLFLFIVVFALLGMQLFGGQ
FNFQDETPTTNFDTFPAAILTVFQILTGEDWNAVMYHGIESQGGVSKGMFSSFYFIVLTL
FGNYTLLNVFLAIAVDNLANAQELTKDEEEMEEAANQKLALQKAKEVAEVSPMSAANISI
AASQEISGATSSVWLHAHPHTSHSHADGRAPALQPATRPAVNTEHRAGCSHSFRKAFESH
LEMAGAASKRKVGCTQLSMAEPSSLEQIEQGQRQGPGEAQADLRHHAERPGTQIQRPRGY
LQRGTWWYWPSEGRCRQSLMRFLSGDGGAPEARSERGRGPGPEGGRRHHRRGSPEEAAER
EPRRHRAHRHQDPSKECAGAKQGAACSRGCGEGGHGEGGHGEGGKGGLKGELLRLAWKEQ
SGPGRRESWGLLWRKERQKGPREPHCDLETSGTVTVGPMHTLPSTCLQKVEEQPEDADNQ
RNVTRMGSQTPDPNTIVHIPVMLTGPPGEATVVPSGNVDLESQAEGKKEVEADDVMRSGP
RPIVPYSSMFCLSPTNLLRRFCHYIVTMRYFEMVILVVITLSSIALAAEDPVHTDSPRNN
ALKYLDYIFTGVFTFEMVIKMIDLGLLLHPGAYFRDLWNILDFIVVSGALVAFAFSGSKG
KDINTIKSLRVLRVLRPLKTIKRLPKLKAVFDCVVNSLKNVLNILIVYMLFMFIFAVIAV
QLFKGKFFYCTDESKELERDCRGQEQDYEKEEVEAQPRQWKKYDFHYDNVLWALLTLFTV
STGEGWPMVLKHSVDATYEEQGPSPGYRMELSIFYVVYFVVFPFFFVNIFVALIIITFQE
QGDKVMSECSLEKNERACIDFAISAKPLTRYMPQNRQSFQYKTWTFVVSPPFEYFIMAMI
ALNTVVLMMKFYDAPYEYELMLKCLNIVFTSMFSMECVLKIIAFGVLNYFRDAWNVFDFV
TVLGSITDILVTEIAETNNFINLSFLRLFRAARLIKLLRQGYTIRILLWTFVQSFKALPY
VCLLIAMLFFIYAIIGMQVFGNIALDDDTSINRHNNFRTFLQALMLLFRSATGEAWHEIM
LSCLSNQACDEQANATECGSDFAYFYFVSFIFLCSFLMLNLFVAVIMDNFEYLTRDSSIL
GPHHLDEFIRVWAEYDPAACCRIHYKDMYSLLRCIAPPVGLGKNCPRRLAYKRLVRMNMP
ISNEDMTVHFTSTLMALIRTALEIKLAPAGTKQHQCDAELRKEISVVWANLPQKTLDLLV
PPHKPDEMTVGKVYAALMIFDFYKQNKTTRDQMQQAPGGLSQMGPVSLFHPLKATLEQTQ
PAVLRGARVFLRQKSSTSLSNGGAIQNQESGIKESVSWGTQRTQDAPHEARPPLERGHST
EIPVGRSGALMQSITRRGPDGEPQPGLESQGRAASMPRLAAETQEEEALAPCVSQPVTDA
SPMKRSISTLAQRPRGTHLCSTTPDRPPPSQARDRKQRSLEKGPSLSADMDGGACGGARR
ERERRQERGRSQERRQPSSSSSEKQRFYSCDRFGGREPPKPKPSLSSHPTSPTAGQEPGP
HPQGSGSVNGSPLLSTSGASTPGRGGRRQLPQTPLTPRPSITYKTANSSPIHFAGAQTSL
PAFSPGRLSRGLSEHNALLQRDPLSQPLAPGSRIGSSVHALPEDTLTFEEAVATNSGRSS
RTSYVSSLTSQSHPLRRVPNGYHCTLGLSSGGRARHSYHHPDQDHWC
Download sequence
Identical sequences ENSGGOP00000004729 ENSGGOP00000004729

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]