SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for ENSGGOP00000004742 from Gorilla gorilla 76_3.1

Domain architecture


Domain assignment details

(
show help)

No Significant Hits.

Weak hits

Sequence:  ENSGGOP00000004742
Domain Number - Region: 366-390
Classification Level Classification E-value
Superfamily EGF/Laminin 0.0159
Family Integrin beta EGF-like domains 0.051
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Biological Process IC (bits) H-Score
Cellular Component IC (bits) H-Score
Molecular Function IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSGGOP00000004742   Gene: ENSGGOG00000004837   Transcript: ENSGGOT00000004864
Sequence length 515
Comment pep:known_by_projection chromosome:gorGor3.1:16:5287573:5296659:-1 gene:ENSGGOG00000004837 transcript:ENSGGOT00000004864 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
MATSTGRWLLLRLALFGFLWEASGGLDSGASRDDDLLLPYPRARARLPRDCTRVRAGSRE
HESWPPTPATPGAGGLAVRTFVSHFRDRAVAGHLTRAVEPLRTFSVLEPGGPGGCAARRR
ATVEETARAADCRVAQNGGFFRMNSGECLGNVVSDERRVSSSGGLQNAQFGIRRDGTLVT
GYLSEEEVLDTENPFVQLLSGVVWLIRNGSIYINESQATECDETQETGSFSKFVNVISAR
TAIGHDRKGQLVLFHADGQTEQRGINLWEMAEFLLKQDVVNAINLDGGGSATFVLNGTLA
SYPSDHCQDNMWRCPRQVSTVVCVHEPRCQPPDCHGHGTCVDGHCQCTGHFWRGPGCDEL
DCGPSNCSQHGLCTETGCRCDAGWTGSNCSEECPLGWHGPGCQRPCKCEHHCPCDPKTGN
CSVSGVKQCLQPPEATLRAGELSFFTRTAWLALTLALAFLLLISTAANLSLLLSRAERNR
RLHGDYAYHPLQEMNGEPLAAEKEQPGGAHNPFKD
Download sequence
Identical sequences G3QQ81
XP_004057191.1.27298 ENSGGOP00000004742 ENSGGOP00000025968

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]