SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for ENSGGOP00000004772 from Gorilla gorilla 76_3.1

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSGGOP00000004772
Domain Number 1 Region: 20-158
Classification Level Classification E-value
Superfamily EF-hand 2.3e-49
Family Calmodulin-like 0.00039
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Biological Process IC (bits) H-Score
Molecular Function IC (bits) H-Score
Cellular Component IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSGGOP00000004772   Gene: ENSGGOG00000004869   Transcript: ENSGGOT00000004895
Sequence length 166
Comment pep:known_by_projection chromosome:gorGor3.1:12:110438269:110448018:-1 gene:ENSGGOG00000004869 transcript:ENSGGOT00000004895 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
MAPKKAKKRAGGANSNVFSMFEQTQIQEFKEAFTIMDQNRDGFIDKNDLRDTFAALGRVN
VKNEEIDEMIKEAPGPINFTVFLTMFGEKLKGADPEETILNAFKVFDPEGKGVLKADYVR
EMLTTQAERFSKEEVDQMFAAFPPDVTGNLDYKNLVHIITHGEEKD
Download sequence
Identical sequences G3QQA8 P10916 Q6IB42
ENSP00000228841 NP_000423.2.87134 NP_000423.2.92137 XP_004053943.1.27298 HR2989 ENSGGOP00000004772 5tby_E 5tby_F 9606.ENSP00000228841 ENSGGOP00000004772 ENSP00000228841 ENSP00000228841 gi|94981553|ref|NP_000423.2|

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]