SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for ENSGGOP00000004798 from Gorilla gorilla 76_3.1

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSGGOP00000004798
Domain Number 1 Region: 167-364
Classification Level Classification E-value
Superfamily E set domains 2.89e-74
Family Cytoplasmic domain of inward rectifier potassium channel 0.0000047
Further Details:      
 
Domain Number 2 Region: 61-183
Classification Level Classification E-value
Superfamily Voltage-gated potassium channels 3.14e-20
Family Voltage-gated potassium channels 0.0045
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Molecular Function IC (bits) H-Score
Cellular Component IC (bits) H-Score
Biological Process IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSGGOP00000004798   Gene: ENSGGOG00000004897   Transcript: ENSGGOT00000004921
Sequence length 391
Comment pep:known_by_projection chromosome:gorGor3.1:11:127079267:127083661:-1 gene:ENSGGOG00000004897 transcript:ENSGGOT00000004921 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
MNASSRNVFETLIRVLTESMFKHLRKWVVTRFFGHSRQRARLVSKDGRCNIEFGNVEAQS
RFIFFVDIWTTVLDLKWRYKMTIFITAFLGSWFFFGLLWYAVAYIHKDLPEFHPSANHTP
CVENINGLTSAFLFSLETQVTIGYGFRCVTEQCATAIFLLIFQSILGVIINSFMCGAILA
KISRPKKRAKTITFSKNAVISKRGGKLCLLIRVANLRKSLLIGSHIYGKLLKTTVTPEGE
TIILDQININFVVDAGNENLFFISPLTIYHVIDHNSPFFHMAAETLLQQDFELVVFLDGT
VESTSATCQVRTSYVPEEVLWGYRFAPIVSKTKEGKYRVDFHNFSKTVEVETPHCAMCLY
NEKDARARMKRGYDNPNFILSEVNETDDTKM
Download sequence
Identical sequences G3QQD3
ENSGGOP00000004798 XP_004052469.1.27298 ENSGGOP00000027211

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]