SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for ENSGGOP00000004812 from Gorilla gorilla 76_3.1

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSGGOP00000004812
Domain Number 1 Region: 59-192
Classification Level Classification E-value
Superfamily EF-hand 1.54e-29
Family Calmodulin-like 0.0000177
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Molecular Function IC (bits) H-Score
Biological Process IC (bits) H-Score
Cellular Component IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSGGOP00000004812   Gene: ENSGGOG00000004911   Transcript: ENSGGOT00000004935
Sequence length 197
Comment pep:known_by_projection chromosome:gorGor3.1:7:45110371:45112608:-1 gene:ENSGGOG00000004911 transcript:ENSGGOT00000004935 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
ASRKAGTRGKVAATKQAQRGSSNVFSMFEQAQIQEFKEASPPPPTFPRAGGCSHLKAPIP
QAFSCIDQNRDGIICKADLRETYSQLGKVSVPEEELDAMLQEGKGPINFTVFLTLFGEKL
NGTDPEEAILSAFRMFDPSGKGVVNKDEFKQLLLTQADKFSPAEVEQMFALTPMDLAGNI
DYKSLCYIITHGDEKEE
Download sequence
Identical sequences A0A2J8L9L9
ENSGGOP00000004812 ENSGGOP00000004812

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]