SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for ENSGGOP00000004822 from Gorilla gorilla 76_3.1

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSGGOP00000004822
Domain Number 1 Region: 326-508
Classification Level Classification E-value
Superfamily NAD(P)-binding Rossmann-fold domains 6.79e-51
Family 6-phosphogluconate dehydrogenase-like, N-terminal domain 0.0000635
Further Details:      
 
Domain Number 2 Region: 38-316
Classification Level Classification E-value
Superfamily ClpP/crotonase 3.69e-47
Family Crotonase-like 0.00032
Further Details:      
 
Domain Number 3 Region: 508-611
Classification Level Classification E-value
Superfamily 6-phosphogluconate dehydrogenase C-terminal domain-like 5.19e-27
Family HCDH C-domain-like 0.00053
Further Details:      
 
Domain Number 4 Region: 634-727
Classification Level Classification E-value
Superfamily 6-phosphogluconate dehydrogenase C-terminal domain-like 4.76e-21
Family HCDH C-domain-like 0.00062
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Cellular Component IC (bits) H-Score
Biological Process IC (bits) H-Score
Molecular Function IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSGGOP00000004822   Gene: ENSGGOG00000004918   Transcript: ENSGGOT00000004945
Sequence length 728
Comment pep:known_by_projection chromosome:gorGor3.1:2a:26623706:26677306:-1 gene:ENSGGOG00000004918 transcript:ENSGGOT00000004945 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
MVACRAIGILSRFSAFRILRSRGYICRNFTGSSALLTRTHINYGVKGDVAVVRINSPNSK
VNTLSKELHSEFSEVMNEIWASDQIRSAVLISSKPGCFIAGADINMLAACKTLQEVTQLS
QEAQRIVEKLEKSTKPIVAAINGSCLGGGLEVAISCQYRIATKDRKTVLGTPEVLLGALP
GAGGTQRLPKMPGLKPPEERTIEYLEEVAITFAKGLADKKISPKRDKGLVEKLTAYAMTI
PFVRQQVYKKVEEKVRKQTKGLYPAPLKIIDVVKTGIEQGSDAGYLSESQKFGELIMTKE
SKALMGLYHGQVLCKKNKFGAPQKDVKHLAILGAGLMGAGIAQVSVDKGLKTILKDATLT
ALDRGQQQVFKGLNDKVKKKALTSFERDSIFSNLTGQLDYQGFEKADMVIEAVFEDLSLK
HRVLKEVEAVIPDHCIFASNTSALPISEIAAVSKRPEKVIGMHYFSPVDKMQLLEIITTE
KTSKDTSASAVAVGLKQGKVIIVVKDGPGFYTTRCLAPMMSEVIRILQEGVDPKKLDSLT
TSFGFPVGAATLVDEVGVDVAKHVAEDLGKVFGERFGGGNPELLTQMVSKGFLGRKSGKG
FYIYQEGVKRKDLNSDMDSILASLKLPPKSEVSSDEDIQFRLVTRFVNEAVMCLQEGILA
TPAEGDIGAVFGLGFPPCLGGPFRFVDLYGAQKIVDRLKKYEAAYGKQFTPCQLLADHAN
SPNKKFYQ
Download sequence
Identical sequences ENSGGOP00000004822

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]