SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for ENSGGOP00000004827 from Gorilla gorilla 76_3.1

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSGGOP00000004827
Domain Number 1 Region: 10-135
Classification Level Classification E-value
Superfamily EF-hand 3.5e-19
Family Calmodulin-like 0.01
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Molecular Function IC (bits) H-Score
Biological Process IC (bits) H-Score
Cellular Component IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSGGOP00000004827   Gene: ENSGGOG00000004927   Transcript: ENSGGOT00000004950
Sequence length 136
Comment pep:known_by_projection chromosome:gorGor3.1:14:71509860:71535228:-1 gene:ENSGGOG00000004927 transcript:ENSGGOT00000004950 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
MFFSEARARSRTWEASPSDHRKWVEVFKACDEDHKGYLSREDFKTAVVMLFGYKPSKIEV
DSVMSSINPNTSGMLLEGFLNIVRKKKEAQRYRNEVRHIFTAFDTYYRGFLTLEDFKKAF
RQVAPKLPERTVLEVF
Download sequence
Identical sequences ENSGGOP00000004827 ENSGGOP00000004827

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]