SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for ENSGGOP00000004834 from Gorilla gorilla 76_3.1

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSGGOP00000004834
Domain Number 1 Region: 131-275
Classification Level Classification E-value
Superfamily PH domain-like 7.68e-42
Family Third domain of FERM 0.00024
Further Details:      
 
Domain Number 2 Region: 447-657
Classification Level Classification E-value
Superfamily DBL homology domain (DH-domain) 1.7e-41
Family DBL homology domain (DH-domain) 0.00058
Further Details:      
 
Domain Number 3 Region: 783-935
Classification Level Classification E-value
Superfamily PH domain-like 3.48e-33
Family Pleckstrin-homology domain (PH domain) 0.003
Further Details:      
 
Domain Number 4 Region: 31-133
Classification Level Classification E-value
Superfamily Second domain of FERM 1.06e-27
Family Second domain of FERM 0.00011
Further Details:      
 
Domain Number 5 Region: 643-767
Classification Level Classification E-value
Superfamily PH domain-like 1.08e-27
Family Pleckstrin-homology domain (PH domain) 0.01
Further Details:      
 
Weak hits

Sequence:  ENSGGOP00000004834
Domain Number - Region: 1-30
Classification Level Classification E-value
Superfamily Ubiquitin-like 0.0118
Family First domain of FERM 0.0085
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Biological Process IC (bits) H-Score
Cellular Component IC (bits) H-Score
Molecular Function IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSGGOP00000004834   Gene: ENSGGOG00000004930   Transcript: ENSGGOT00000004957
Sequence length 952
Comment pep:known_by_projection chromosome:gorGor3.1:13:81344280:81430832:1 gene:ENSGGOG00000004930 transcript:ENSGGOT00000004957 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
VWLDLLKPIVKQIRRPKHVVVKFVVKFFPPDHTQLQEELTRYLFALQVKQDLAQGRLTCN
DTSAALLISHIVQSEIGDFDEALDREHLAKNKYIPQQDALEDKIVEFHHNHIGQTPAESD
FQLLEIARRLEMYGIRLHPAKDREGTKINLAVANTGILVFQGFTKINAFNWAKVRKLSFK
RKRFLIKLRPDANSAYQDTLEFLMASRDFCKSFWKICVEHHAFFRLFEEPKPKPKPVLFS
RGSSFRFSGRTQKQVLDYVKEGGHKKVQFERKHSKIHSIRSLASQPTELNSEVLEQSQQS
ASLTFGEGAESPGGQSCRQGKEPKVSAGEPGSHPSPAPRRSPAGNKQADGAASAPTEEEE
EVVKDRTQQSKPQPPQPSTGSLTGSPHLSELSVNSQGGVAPANVTLSPNLSPDTKQASPL
ISPLLNDQACPRTDDEDEGRRKRFPTDKAYFIAKEVSTTERTYLKDLEVITSWFQSTVSK
EDAMPEALKSLIFPNFEPLHKFHTNFLKEIEQRLALWEGRSNAQIRDYQRIGDVMLKNIQ
GMKHLAAHLWKHSEALEALENGIKSSRRLENFCRDFELQKVCYLPLNTFLLRPLHRLMHY
KQVLERLCKHHPXXHVCLSFTAALAEITEMVAQLHGTMIKMENFQKLHELKKDLIGIDNL
VVPGREFIRLGSLSKLSGKGLQQRMFFLFNDVLLYTSRGLTASNQFKVHGQLPLYGMTIE
ESEDEWGVPHCLTLRGQRQSIIVAASSRSEMEKWVEDIQMAIDLAEKSSSPAPEFLASSP
PDNKSPDEATAADQESEDDLSASRTSLERQAPHRGNTMVHVCWHRNTSVSMVDFSIAVEN
QLSGNLLRKFKNSNGWQKLWVVFTNFCLFFYKSHQDNHPLASLPLLGYSLTIPSESENIQ
KDYVFKLHFKSHVYYFRAESEYTFERWMEVIRSATSSASRPHVLSHKESLVY
Download sequence
Identical sequences ENSGGOP00000004834 ENSGGOP00000004834

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]