SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for ENSGGOP00000004839 from Gorilla gorilla 76_3.1

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSGGOP00000004839
Domain Number 1 Region: 15-174
Classification Level Classification E-value
Superfamily EF-hand 2.86e-24
Family Calmodulin-like 0.01
Further Details:      
 
Domain Number 2 Region: 147-226
Classification Level Classification E-value
Superfamily EF-hand 0.0000000000763
Family Calmodulin-like 0.033
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Biological Process IC (bits) H-Score
Cellular Component IC (bits) H-Score
Molecular Function IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSGGOP00000004839   Gene: ENSGGOG00000004938   Transcript: ENSGGOT00000004962
Sequence length 263
Comment pep:known_by_projection chromosome:gorGor3.1:8:88852644:88876935:-1 gene:ENSGGOG00000004938 transcript:ENSGGOT00000004962 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
TMAESHLQSSLITASQFFEIWLHFDADGSGYLEGKELQNLIQELQQARKKAGLELSPEMK
TFVDQYGQRDDGKIGIVELAHVLPTEENFLLLFRCQQLKSCEEFMKTWRKYDTDHSGFIE
TEELKNFLKDLLEKANKTVDDTKLAEYTDLMLKLFDSNNDGKLELTEMARRLLPVQENFL
LKFQGIKMCGKEFNKAFELYDQDGNGYIDENELDALLKDLCEKNKQDLDINNITTYKKNI
MALSDGGKLYRTDLALILCAGDN
Download sequence
Identical sequences ENSGGOP00000004839 ENSGGOP00000004839

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]