SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for ENSGGOP00000004848 from Gorilla gorilla 76_3.1

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSGGOP00000004848
Domain Number 1 Region: 6-67
Classification Level Classification E-value
Superfamily SNARE fusion complex 0.00000000000000204
Family SNARE fusion complex 0.0011
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Cellular Component IC (bits) H-Score
Molecular Function IC (bits) H-Score
Biological Process IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSGGOP00000004848   Gene: ENSGGOG00000004951   Transcript: ENSGGOT00000004971
Sequence length 116
Comment pep:known_by_projection chromosome:gorGor3.1:2a:87107340:87119216:1 gene:ENSGGOG00000004951 transcript:ENSGGOT00000004971 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
MAGIELERCQQQANEVTEIMRNNFGKVLERGVKLAELQQRSDQLLDMSSTFNKTTQNLAQ
KKCWENIRYRICVGLVVVGVLLIILIVLLVVFLPQSSDSSSAPRTQDAGTASGPGN
Download sequence
Identical sequences G3QQI2
XP_004029597.1.27298 ENSGGOP00000004848 ENSGGOP00000004848

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]