SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for ENSGGOP00000004871 from Gorilla gorilla 76_3.1

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSGGOP00000004871
Domain Number 1 Region: 35-167
Classification Level Classification E-value
Superfamily Concanavalin A-like lectins/glucanases 3.31e-40
Family Galectin (animal S-lectin) 0.0000371
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Molecular Function IC (bits) H-Score
Biological Process IC (bits) H-Score
Cellular Component IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSGGOP00000004871   Gene: ENSGGOG00000004974   Transcript: ENSGGOT00000004996
Sequence length 168
Comment pep:known_by_projection chromosome:gorGor3.1:19:37108057:37114089:1 gene:ENSGGOG00000004974 transcript:ENSGGOT00000004996 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
MSLTHRLHLCKYWGCAVSNVCRFLEGRPLPLMIVVPYTLPVSLPVGSCVIITGTPILTFV
KDPQLEVNFYTGMDEDSDIAFQFRLHFGHPAIMNSRVFGIWRYEEKCYYLPFEDGKPFEL
CIHVRHKEYKVMVNGQRIYNFAHRFPPASVKMLQVLRDISLTRVLISD
Download sequence
Identical sequences ENSGGOP00000004871 ENSGGOP00000004871

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]