SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for ENSGGOP00000004891 from Gorilla gorilla 76_3.1

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSGGOP00000004891
Domain Number 1 Region: 901-952
Classification Level Classification E-value
Superfamily Glucocorticoid receptor-like (DNA-binding domain) 0.0000000000000209
Family Erythroid transcription factor GATA-1 0.0024
Further Details:      
 
Domain Number 2 Region: 1229-1276
Classification Level Classification E-value
Superfamily beta-beta-alpha zinc fingers 0.0000402
Family Classic zinc finger, C2H2 0.026
Further Details:      
 
Weak hits

Sequence:  ENSGGOP00000004891
Domain Number - Region: 702-745
Classification Level Classification E-value
Superfamily beta-beta-alpha zinc fingers 0.0357
Family Classic zinc finger, C2H2 0.015
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Cellular Component IC (bits) H-Score
Molecular Function IC (bits) H-Score
Biological Process IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSGGOP00000004891   Gene: ENSGGOG00000004993   Transcript: ENSGGOT00000005016
Sequence length 1294
Comment pep:known_by_projection chromosome:gorGor3.1:8:114842925:115103526:-1 gene:ENSGGOG00000004993 transcript:ENSGGOT00000005016 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
MPYEVNAGYDFTNMVRKKNPPLRNVASEGEGQILEPIGTESKVSGKNKEFSADQMSENTD
QSDAAELNHKEEHSLHVQDPSSSSKKDLKSAVLSEKAGFNYESPSKGGNFPSFPHDEVTD
RNMLAFSSPAAGGVCEPLKSPQRAEADDPQDMACTPSGDSVETKEDQKMSPKATEETGQA
QSGQANCQGLSPVSVASKNPQVPSDGGVRLNKSKTDLLVNDNPDPAPLSPELQDFKCNIC
GYGYYGNDPTDLIKHFRKYHLGLHNRTRQDAELDSKILALHNMVQFSHSKDFQKVNRSVF
SGVLQDINSSRPVLLNGTYDVQVTSGGTFIGIGRKTPDCQGNTKYFRCKFCNFTYMGNSS
TELEQHFLQTHPNKIKASLPSSEVAKPSEKNSNKSIPALRSSDSGDLGKWQDKITVKAGD
DTPVGYSVPIKPLDSSRQNGTEATSYYWCKFCSFSCESSSSLKLLEHYGKQHGAVQSGGL
NPELNDKLSRGSVINQNDLAKSSEGETMTKTDKSSSGAKKKDFSSKGAEDNMVTSYNCQF
CDFRYSKSHGPDVIVVGPLLRHYQQLHNIHKCTIKHCPFCPRGLCSPEKHLGEITYPFAC
RKSNCSHCALLLLHLSSGAAGSSRVKHQCHQCSFTTPDVDVLLFHYESVHESQASDVKQE
ANHLQGSDGQQSVKESKEHSCTKCDFITQVEEEISRHYRRAHSCYKCRQCSFTAADTQSL
LEHFNTVHCQEQDITTANGEEDGHAISTIKEEPKIDFRVYNLLTPDSKMGEPVSESVVKR
EKLEEKEGLKEKVWTESSSDDLRNVTWRGADILRGSPSYTQASLGLLTSVSGTQEQTKTL
RDSPNVEAAHLARPIYGLAVETKGFLQGAPAGGEKSGALPQQYPASGENKSKDESQSLLR
RRRGSGVFCANCLTTKTSLWRKNANGGYVCNACGLYQKLHSTPRPLNIIKQNNGEQIIRR
RTRKRLNPEALQAEQLNKQQRGSNEEQVNGSPLERRSEDHLTESHQREIPLPSLSKYEAQ
GSLTKSHSAQQPVLVSQTLDIHKRMQPLHIQIKSPQESTGDPGNSSSVSEGKGSSERGSP
IEKYMRPAKHPNYSPPGSPIEKYQYPLFGLPFVHNDFQSEADWLRFWSKYKLSVPGNPHY
LSHVPGLPNPCQNYVPYPTFNLPPHFSAVGSDNDIPLDLAIKHSRPGPTANGASKEKTKA
PPNVKNEGPLNVVKTEKVDRSTQDELSTKCVHCGIVFLDEVMYALHMSCHGDSGPFQCSI
CQHLCTDKYDFTTHIQRGLHRNNAQVEKHGKPKE
Download sequence
Identical sequences A0A2I2Y5U4
ENSGGOP00000004891 ENSGGOP00000004891

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]