SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for ENSGGOP00000004927 from Gorilla gorilla 76_3.1

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSGGOP00000004927
Domain Number 1 Region: 87-276
Classification Level Classification E-value
Superfamily HIT-like 1.17e-67
Family mRNA decapping enzyme DcpS C-terminal domain 0.0000000071
Further Details:      
 
Domain Number 2 Region: 42-87
Classification Level Classification E-value
Superfamily mRNA decapping enzyme DcpS N-terminal domain 0.00000000262
Family mRNA decapping enzyme DcpS N-terminal domain 0.00033
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Biological Process IC (bits) H-Score
Molecular Function IC (bits) H-Score
Cellular Component IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSGGOP00000004927   Gene: ENSGGOG00000005028   Transcript: ENSGGOT00000005054
Sequence length 278
Comment pep:known_by_projection chromosome:gorGor3.1:11:124495739:124540843:1 gene:ENSGGOG00000005028 transcript:ENSGGOT00000005054 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
MADAAPQLGKRKRELDVEEAHAASTEEKEAGVGNGTCAPVRLPFSGFRLQKVLRESARDK
IIFLHGKVKTTVVYPATEKHLQKYLRQDLRLIRETGDDYRNITLPHLESQSLSIQWVYNI
LDKKAEADRIVFENPDPSDGFVLIPDLKWNQQQLDDLYLIAICHRRGIRSLRDLTPEHLP
LLRNILHQGQEAILQRYRMKGDHLRVYLHYLPSYYHLHVHFTALGFEAPGSGVERAHLLA
EVIENLECDPRHYQQRTLTFALRADDPLLKLLQEAQQS
Download sequence
Identical sequences G3QQQ4
ENSGGOP00000004927

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]