SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for ENSGGOP00000004928 from Gorilla gorilla 76_3.1

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSGGOP00000004928
Domain Number 1 Region: 386-574
Classification Level Classification E-value
Superfamily Nucleotidyltransferase 1.31e-61
Family DNA polymerase beta-like 0.0000000111
Further Details:      
 
Domain Number 2 Region: 236-328
Classification Level Classification E-value
Superfamily DNA polymerase beta, N-terminal domain-like 3.4e-28
Family DNA polymerase beta, N-terminal domain-like 0.00000714
Further Details:      
 
Domain Number 3 Region: 330-384
Classification Level Classification E-value
Superfamily PsbU/PolX domain-like 2.45e-17
Family DNA polymerase beta-like, second domain 0.0000836
Further Details:      
 
Domain Number 4 Region: 40-132
Classification Level Classification E-value
Superfamily BRCT domain 0.000000000000189
Family BRCT domain 0.065
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Biological Process IC (bits) H-Score
Molecular Function IC (bits) H-Score
Cellular Component IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSGGOP00000004928   Gene: ENSGGOG00000005029   Transcript: ENSGGOT00000005055
Sequence length 575
Comment pep:known_by_projection chromosome:gorGor3.1:10:115107864:115117151:-1 gene:ENSGGOG00000005029 transcript:ENSGGOT00000005055 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
MDPRGILKAFPKRKKIHADASSKVLAKIPRREEGEEAEEWLSSLRAHVVRTGIGRARAEL
FEKQIVQHGGQLCPAQGPGVTHIVVDEGMDYERALRLLRLPQLPPGAQLVKSAWLSLCLQ
ERRLVDVAGFSIFIPSRYLDQPQPSKAEQDASIPPGTHEALLQTALSPPPPPTRPVSPPQ
KAKEAPNTQAQPISDDEASDGEETQVSAADLEALISGHYPTSLEGDCEPSPAPAVLDKWV
CAQPSSQKATNHNLHITEKLEVLAKAYSVQGDKWRALGYAKAINALKSFHKPVTSYQEAC
SIPGIGKRMAEKIIEILESGHLRKLDHISESVPVLELFSNIWGAGTKTAQMWYQQGFRSL
EDIHSQASLTTQQAIGLKHYSDFLERMPREEATEIEQTVQKAAQAFNSGLLCVACGSYRR
GKATCGDVDVLITHPDGRSHRGIFSRLLDSLRQQGFLTDDLVSQEENGQQQKYLGVCRLP
GPGWRHRRLDIIVVPYSEFACALLYFTGSAHFNRSMRALAKTKGMSLSEHALSTAVVRNT
HGCKVGSGRVLPTPTEKDVFRLLGLPYREPAERDW
Download sequence
Identical sequences E5FGJ0 G3QQQ5
ENSGGOP00000004928 XP_018890727.1.27298 XP_018890728.1.27298 ENSGGOP00000004928

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]