SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for ENSGGOP00000004946 from Gorilla gorilla 76_3.1

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSGGOP00000004946
Domain Number 1 Region: 153-284
Classification Level Classification E-value
Superfamily Ubiquitin-like 7.49e-22
Family UBX domain 0.015
Further Details:      
 
Domain Number 2 Region: 6-54
Classification Level Classification E-value
Superfamily UBA-like 8.62e-17
Family UBA domain 0.00019
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Molecular Function IC (bits) H-Score
Cellular Component IC (bits) H-Score
Biological Process IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSGGOP00000004946   Gene: ENSGGOG00000005047   Transcript: ENSGGOT00000005073
Sequence length 310
Comment pep:known_by_projection chromosome:gorGor3.1:11:59461655:59463874:-1 gene:ENSGGOG00000005047 transcript:ENSGGOT00000005073 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
MAELTALESLIEMGFPRGRAEKALALTGNQGIEAAMDWLMEHEDDPDVDEPLETPLGHIL
GREPTSSEQGGLEGSGSAAGEGKPVLSEEERQEQTKRMLELVAQKQREREEREEREALER
ERQRRRQGQELSAARQRLQEDEMRRAAEERRREKAEELAARQRVREKIERDKAERAKKYG
GSVGSQPPPAAPEPGPVPSSPSQEPPTKREYDQCRIQVRLPDGTSLTQTFRAREQLAAVR
LYVELHRGEEPGGGQDPVQLLSGFPRRAFSEADMERPLQELGMAARLETRTWGSREACLG
KGGMQREGAL
Download sequence
Identical sequences A0A2I2Z0M5
ENSGGOP00000020899 XP_018891445.1.27298 ENSGGOP00000004946

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]