SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for ENSGGOP00000004956 from Gorilla gorilla 76_3.1

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSGGOP00000004956
Domain Number 1 Region: 735-935
Classification Level Classification E-value
Superfamily Concanavalin A-like lectins/glucanases 3.02e-42
Family Laminin G-like module 0.00038
Further Details:      
 
Domain Number 2 Region: 306-510
Classification Level Classification E-value
Superfamily Concanavalin A-like lectins/glucanases 1.25e-39
Family Laminin G-like module 0.0012
Further Details:      
 
Domain Number 3 Region: 529-736
Classification Level Classification E-value
Superfamily Concanavalin A-like lectins/glucanases 1.07e-37
Family Laminin G-like module 0.0013
Further Details:      
 
Domain Number 4 Region: 36-184
Classification Level Classification E-value
Superfamily Fibronectin type III 3.11e-26
Family Fibronectin type III 0.0026
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Cellular Component IC (bits) H-Score
Biological Process IC (bits) H-Score
Molecular Function IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSGGOP00000004956   Gene: ENSGGOG00000005053   Transcript: ENSGGOT00000005083
Sequence length 960
Comment pep:known_by_projection chromosome:gorGor3.1:17:55230658:55432718:-1 gene:ENSGGOG00000005053 transcript:ENSGGOT00000005083 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
MDLIRGVLLRLLLLASSLGPGAVSLRAAIRKPGKVGPPLDIKLGALNCTAFSIQWKMPRH
PGSPILGYTVFYSEVGADKSLQEQLHSVPLSRDIPITEEVIGDLKPDTEYRVSIAAYSQA
GKGRLSSPRHVTTLSQESCLPPAAPQQPHVIVVSDSEVALSWKPGASEGSAPIQYYSVEF
IPEEAGSGRYGPRYITDMGAGEDDEGFEDDLDLDISFEEVKPLPATKGGNKKFLVESKKM
SISNPKTISRLIPPTSASLPMTTVAPQPIPVQRKGKNGVAIMSRLFDMPCDETLCSADSF
CVNDYTWGGSRCQCTLGKGGESCSEDIVIQYPQFFGHSYVTFEPLKNSYQAFQITLEFRA
EAEDGLLLYCGENEHGRGDFMSLAIIRRSLQFRFNCGTGVAIIVSETKIKLGGWHTVMLY
RDGLNGLLQLNNGTPVTGQSQGQYSKITFRTPLYLGGAPSAYWLVRATGTNRGFQGCVQS
LAVNGRRIDMRPWPLGKALSGADVGECSSGICDEASCINGGTCTAIKADSYICLCPLGFK
GRHCEDAFTLTIPQFRESLRSYAATPWPLEPQHYLSFMEFEITFRPDSGDGVLLYSYDTG
SKDFLSINLAGDHVEFRFDCGSGTGVLRSEDPLTLGNWHELHVSRTAKNGILQVDKQKIV
EGMAEGGFTQIKCNTDIFIGGVPNYDDVKKNSGVLKPFSGSIQKIILNDRTIHVKHDFTS
GVNVENAAHPCVRAPCAHGGSCRPRKEGYDCDCPLGFEGLHCQKECGNYCLNTIIEAIEI
PQFIGRSYLTYDNPDILKRVSGSRSNVFMRFKTTAKDGLLLWRGDSPMRPNSDFISLGLR
DGALVFSYNLGSGVASIMVNGSFNDGRWHRVKAVRDGQSGKITVDDYGARTGKSPGMMRQ
LNINGALYVGGMKEIALHTNRQYMRGLVGCISHFTLSTDYHISLVEDAVDGKNINTCGAK
Download sequence
Identical sequences G3QQT2
ENSGGOP00000004956 ENSGGOP00000004956

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]