SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for ENSGGOP00000005030 from Gorilla gorilla 76_3.1

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSGGOP00000005030
Domain Number 1 Region: 206-310
Classification Level Classification E-value
Superfamily PDZ domain-like 5.26e-27
Family PDZ domain 0.0061
Further Details:      
 
Domain Number 2 Region: 1203-1319
Classification Level Classification E-value
Superfamily PDZ domain-like 3.42e-23
Family Interleukin 16 0.00000712
Further Details:      
 
Domain Number 3 Region: 1105-1196
Classification Level Classification E-value
Superfamily PDZ domain-like 5.13e-21
Family Interleukin 16 0.0000418
Further Details:      
 
Domain Number 4 Region: 333-443
Classification Level Classification E-value
Superfamily PDZ domain-like 2.13e-18
Family PDZ domain 0.022
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Biological Process IC (bits) H-Score
Molecular Function IC (bits) H-Score
Cellular Component IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSGGOP00000005030   Gene: ENSGGOG00000005128   Transcript: ENSGGOT00000005159
Sequence length 1331
Comment pep:known_by_projection chromosome:gorGor3.1:15:61010164:61131945:1 gene:ENSGGOG00000005128 transcript:ENSGGOT00000005159 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
MESHSRAGKSRKSAKFRSISRSLMLCNAKTSDDGSSPDEKYPDPFEISLAQGKEGVFHSS
VQLADTSEAGPSSVPDLALASEAAQLQAAGNDRGKTCRRIFFMKESSTASSREKPGKLEA
QSSNFLFPKACHQRARSNSTSVNPYCTREIDFPMTKKSAAPTDRQPYSLCSNRKSLSQQL
DCPAGKAAGTSRPTRSLSTAQLVQPSGGLQASVISNIVLMKGQAKGLGFSIVGGKDSIYG
PIGIYVKTIFAGGAAAADGRLQEGDEILELNGESMAGLTHQDALQKFKQAKKGLLTLTVR
TRLTAPPSLCSHLSPPLCRSLSSSTCITKDSSSFALESPSAPISTAKPNYRIMVEVSLQK
EAGVGLGIGLCSVPYFQCISGIFVHTLSPGSVAHLDGRLRCGDEIVEISDSPVHCLTLNE
VYTILSHCDPGPVPIIVSRHPDPQVSEQQLKEAVAQAVENTKFGKERHQWSLEGVKRLES
SWHGRPTLEKEREKNSAPPHRRAQKVMIRSSSDSSYMSGSPGGSPGSGSAEKPSSDVDIS
THSPSLPLAREPVVLSIASSRLPQESPPLPESRDSHPPLRLKKPFEILVRKPTSSKPKPP
PRKYFKSDSDPQKSLEERENSCSSGHTPPTCGQEARELLPLLLPQEDTAGRSPSASAGCP
GPGIGPQTKSSTEGEPGWRRASPVTQTSPIKHPLLKRQARMDYSFDTTAEDPWVRISDCI
KNLFSPIMSENHGHMPLQPNASLNEEDGTQGHPDGTPPKLDTADGTPKVYKSADSSTVKK
GPPVAPKPAWFRQSLKGLRNRASDPRGLPDPALSTQPAPASREHLGSHIRASSSSSSIRQ
RISSFETFGSSQLPDKGAQRLSLQPSSGEAAKPLGKHEEGRFSGLLGRGAASTLVPQQPE
QVLSSGSPAASEARDPGVSESPPPGRQPNQKPLPTGPDPLLRLLSTQTEESQGPVLKMPS
QRARSFPLTRSQSCETKLLDEKTSKLYSISSQVSSAVMKSLLCLPSSISCAQTPCIPKEG
ASPTSSSNEDSAANGSVETSALDTGFSLNLSELREYTEGLTEAKEDDDGDHSSLQSGQSV
ISLLSSEELKKLIEEVKVLDEATLKQLDSIHVTILHKEEGAGLGFSLAGGADLENKVITV
HRVFPNGLASQEGTIQKGNEVLSINGKSLKGTTHSDALAILRQAREPRQAVIVTRKLTPE
AMPDLNSSTDSAASASAASDVSVESTAEATVCTVTLEKMSAGLGFSLEGGKGSLHGDKPL
TINRIFKGAASEQSETVQPGDEILQLAGTAMQGLTRFEAWNIIKALPDGPVTIVIRRKSL
QSKETTAAGDS
Download sequence
Identical sequences ENSGGOP00000005030 ENSGGOP00000005030

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]