SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for ENSGGOP00000005073 from Gorilla gorilla 76_3.1

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSGGOP00000005073
Domain Number 1 Region: 1132-1383
Classification Level Classification E-value
Superfamily PP2C-like 8.24e-45
Family PP2C-like 0.0017
Further Details:      
 
Domain Number 2 Region: 791-1109
Classification Level Classification E-value
Superfamily L domain-like 2.15e-43
Family Leucine rich effector protein YopM 0.0044
Further Details:      
 
Domain Number 3 Region: 596-839
Classification Level Classification E-value
Superfamily L domain-like 5.1e-35
Family Internalin LRR domain 0.037
Further Details:      
 
Domain Number 4 Region: 330-362,494-596
Classification Level Classification E-value
Superfamily PH domain-like 0.0000000158
Family Pleckstrin-homology domain (PH domain) 0.023
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Biological Process IC (bits) H-Score
Cellular Component IC (bits) H-Score
Molecular Function IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSGGOP00000005073   Gene: ENSGGOG00000005176   Transcript: ENSGGOT00000005204
Sequence length 1681
Comment pep:known_by_projection chromosome:gorGor3.1:18:60896231:61170247:1 gene:ENSGGOG00000005176 transcript:ENSGGOT00000005204 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
MEPAAAATVQRLPELGREDRASAPAAAAAAAAAAAAAAAALAAAAGGGRSPEPALTPAAP
SGGNGSGGGAREEAPGEAPLGPLPGRAGGAGRRRRRGAPQPIAGGAAPVPGAGGGANSLL
LRRGRLKRNLSAAAAAASSSSSSSAAAASHSPGAAGLPASCSASASLCTRSLDRKTLLLK
HRQTLQLQPSDRDWVRHQLQRGCVHVFDRHMASTYLRPVLCTLDTTAGEVAARLLQLGHK
GGGVVKVLGQGPGAAAAREPAEPPPEAGPRLAPPEPRDSEVPPARSAPGAVGGPPRAPPA
DLPLPVGGPGGWSRRASPAPSDSSPGEPFVGGPVSSPRAPRPVVSDTESFSLSPSAESVS
DRLDPYSSGGGSSSSSEELEADAASAPTGVPGQPRRPGHPAQPLPLPQTASSPQPQQKAP
RAIDSPGGAVTLYVQLHGETTRRLEAEEKPLQIQNDYLFQLGFGELWRVQEEGMDSEIGC
LIRFYAGKPHSTGSSERIQLSGMYNVRKGKMQLPVNRWTRRQVILCGTCLIVSSVKDSLT
GKMHVLPLIGGKVEEVKKHQHCLAFSSSGPQSQTYYICFDTFTEYLRWLRQVSKVASQRI
SSVDLSCCSLEHLPANLFYSQDLTHLNLKQNFLRQNPSLPAARGLNELQRFTKLKSLNLS
NNHLGDFPLAVCSIPTLAELNVSCNALRSVPAAVGVMHNLQTFLLDGNFLQSLPAELENM
KQLSYLGLSFNEFTDIPEVLEKLTAVDKLCMSGNCVETLRLQALRKMPHIKHVDLRLNVI
RKLIADEVDFLQHVTQLDLRDNKLGDLDAMIFNNIEVLHCERNQLVTLDICGYFLKGLYA
SSNELVQLDVYPVPNYLSYMDVSRNRLENVPEWVCESRKLEVLDIGHNQICELPARLFCN
SSLRKLLAGHNQLARLPERLERTSVEVLDVQHNQLLELPPNLLMKADSLRFLNASANKLE
SLPPATLSEETNSILQELYLTNNSLTDKCVPLLTGHPHLKILHMAYNRLQSFPASKMAKL
EELEEIDLSGNKLKAIPTTIMNCRRMHTVIAHSNCIEVFPEVMQLPEIKCVDLSCNELSE
VTLPENLPPKLQELDLTGNPRLVLDHKTLELLNNIRCFKIDQPSTGDPSGAPAVWSHGYT
EASGVKNKLCVAALSVNNFCDNREALYGVFDGDRNVEVPYLLQCTMSDILAEELQKTKNE
EEYMVNTFIVMQRKLGTAGQKLGGAAVLCHIKHDPVDPGGSFTLTSANVGKCQTVLCRNG
KPLPLSRSYIMSCEEELKRIKQHKAIITEDGKVNGVTESTRILGYTFLHPSVVPRPHVQS
VLLTPQDEFFILGSKGLWDSLSVEEAVEAVRNVPDALAAAKKLCTLAQSYGCHDSISAVV
VQLSVTEDSFCCCELSAGGAVPPPSPGIFPPSVNMVIKDRPSDGLGVPSSSSGMASEISS
ELSTSEMSSEVGSTASDEPPPGALSENSPAYPSEQRCMLHPICLSNSFQRQLSSATFSSA
FSDNGLDSDDEEPIEGVFTNGSRVEVEVDIHCSRAKEKEKQQHLLQVPAEASDEGIVISA
NEDEPGLPRKADFSAVGTIGRRRANGSVAPQERSHNVIEVATDAPLRKPGGYFAAPAQPD
PDDQFIIPPELEEEVKEIMKHHQEQQQQQQQQQPPPPPQLQPQLPRHYQLDQLPDYYDTP
L
Download sequence
Identical sequences ENSGGOP00000005073 ENSGGOP00000005073

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]