SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for ENSGGOP00000005087 from Gorilla gorilla 76_3.1

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSGGOP00000005087
Domain Number 1 Region: 124-198
Classification Level Classification E-value
Superfamily Delta-sleep-inducing peptide immunoreactive peptide 3.01e-29
Family Delta-sleep-inducing peptide immunoreactive peptide 0.0000131
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Molecular Function IC (bits) H-Score
Cellular Component IC (bits) H-Score
Biological Process IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSGGOP00000005087   Gene: ENSGGOG00000005193   Transcript: ENSGGOT00000005218
Sequence length 200
Comment pep:known_by_projection chromosome:gorGor3.1:X:105102780:105174935:-1 gene:ENSGGOG00000005193 transcript:ENSGGOT00000005218 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
MAQSKLDCRSPVGLDCCNCCLDLAHRSGLQRGSSGENNNPGSPIVSNFRQLQEKLVFENL
NTDKLNSIMRQDSLEPVLRDPCYLINEGICNRNIDQTMLSILLFFHSASGASVVAIDNKI
EQAMDLVKNHLMYAVREEVEILKEQIRELVEKNSQLERENTLLKTLASPEQLEKFQSCLS
PEEPAPESPQVPEAPGGSAV
Download sequence
Identical sequences G3QR51
ENSGGOP00000005087 ENSGGOP00000023574 XP_018875001.1.27298 XP_018875002.1.27298 XP_018875003.1.27298

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]