SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for ENSGGOP00000005097 from Gorilla gorilla 76_3.1

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSGGOP00000005097
Domain Number 1 Region: 65-330,399-445
Classification Level Classification E-value
Superfamily (Trans)glycosidases 1.66e-86
Family Type II chitinase 0.000000522
Further Details:      
 
Domain Number 2 Region: 326-394
Classification Level Classification E-value
Superfamily Chitinase insertion domain 1.13e-19
Family Chitinase insertion domain 0.00031
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Molecular Function IC (bits) H-Score
Cellular Component IC (bits) H-Score
Biological Process IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSGGOP00000005097   Gene: ENSGGOG00000005204   Transcript: ENSGGOT00000005228
Sequence length 741
Comment pep:known_by_projection chromosome:gorGor3.1:1:114390485:114402881:-1 gene:ENSGGOG00000005204 transcript:ENSGGOT00000005228 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
DLSSRGGIEPQCSSEVYFRARERGCENVAWSLGLRSHCFLEAELHPLPWFLPTNVCSPLP
GAAHKLVCYFTNWAHSRPGPASILPHDLDPFLCTHLIFAFASMNNNQIVAKDLQDEKILY
PEFNKLKERMQQLPTRAKNPAHQPSLSHHRNRELKTLLSIGGWNFGTSRFTTMLSTFANR
EKFIASVISLLRTHDFDGLDLFFLYPGLRGSPMHDRWTFLFLIEELLFAFRKEALLTMRP
RLLLSAAVSGVPHIVQTSYDVRFLGRLLDFINVLSYDLHGSWERFTGHNSPLFSLPEDPK
SSAYAMNYWRKLGAPSEKLIMGIPTYGRTFRLLKASKNGLQARAIGPASPGKYTKQEGFL
AYFEICSFVWGAKKHWIDYQYVPYANKGKEWVGYDNAISFSYKAWFIRREHFGGAMVWTL
DMDDVRGTFCGTGPFPLVYVLNDILVRAEFSSTSLPQFWLSSAVNSSSTDPERLAVTTAW
TTDSKILPPGGEAGVTEIHGKCENMTITPRSTTVTPTKETVSLGKHTVALGEKTEITGAT
TMTSVGHQSMTPGEKALTPVGHQSVTTGQKTLTSVGYQSVTPGEKTLTPVGHQSVTPVSH
QSVSPGGTTMTPVHFQTETLRQNTVAPRRKAVAREKVTVPSRNISVTSEGQTMPLRGENL
TSEVGTHPRMGNLGLQMEAENRMMLSSSPVIQLPEHTPLAFDNRFVPIYGNHSSVNSVTP
QTSPLSLKKEIPENSAVDQEA
Download sequence
Identical sequences ENSGGOP00000026079 ENSGGOP00000005097

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]