SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for ENSGGOP00000005161 from Gorilla gorilla 76_3.1

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSGGOP00000005161
Domain Number 1 Region: 171-291
Classification Level Classification E-value
Superfamily cAMP-binding domain-like 3.4e-16
Family cAMP-binding domain 0.011
Further Details:      
 
Domain Number 2 Region: 3-70,110-161
Classification Level Classification E-value
Superfamily cAMP-binding domain-like 0.0000000912
Family cAMP-binding domain 0.032
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Cellular Component IC (bits) H-Score
Biological Process IC (bits) H-Score
Molecular Function IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSGGOP00000005161   Gene: ENSGGOG00000005268   Transcript: ENSGGOT00000005295
Sequence length 294
Comment pep:known_by_projection chromosome:gorGor3.1:8:85907775:86084887:1 gene:ENSGGOG00000005268 transcript:ENSGGOT00000005295 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
LRPIHRTPYEHKTVWKFLKTIPDLTFQLNDKHLKTLSKTVFSETWLKGSTVVANDGFYVI
LKGLARPQTNVYKNLIEGSDSPDSFIPQSFHSFIWSEEFKNSTLAEMYLPSYDSMLSKWS
TFGTLEVIPQIESETQMFSVVTEDDCEILKIPAKGYAKIKEEKIKLENMQKLKLIRMCPY
YEEWPTLSIYELIALLKWKKFPPGHVIVESGNIISFVGYINSGCCNIYRSIIGFVKLRSN
KVKRSQKLVYMGKLKEKESFGEISVLLQVPFTCTIITKKEVEMAVIEDKDLFVA
Download sequence
Identical sequences ENSGGOP00000005161 ENSGGOP00000005161

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]