SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for ENSGGOP00000005162 from Gorilla gorilla 76_3.1

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSGGOP00000005162
Domain Number 1 Region: 47-243
Classification Level Classification E-value
Superfamily Voltage-gated potassium channels 2.24e-46
Family Voltage-gated potassium channels 0.0014
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Biological Process IC (bits) H-Score
Cellular Component IC (bits) H-Score
Molecular Function IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSGGOP00000005162   Gene: ENSGGOG00000005274   Transcript: ENSGGOT00000005296
Sequence length 299
Comment pep:known_by_projection chromosome:gorGor3.1:18:78380832:78417717:1 gene:ENSGGOG00000005274 transcript:ENSGGOT00000005296 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
MEPWPCSPGGGGGGGGGTRARHVIINLCLSTMPDIRAEEERGECSPKCRSLFVLETVCVA
WFSFEFLLRSLQAESKCAFLRAPLNIIDILALLPFYVSLLLGLAAGPGGTKLLERAGLVL
RLLRALRVLYVMRLARHSLGLRSLGLTVRRCAREFGLLLLFLCVAMALFAPLVHLAEREL
GARRDFSSVPASYWWAVISMTTVGYGDMVPRSLPGQVVALSSILSGILLMAFPVTSIFHT
FSRSYSELKEQQQRAASPEPALQEDSTHSATATEDSSQGPDSAGLADDSADALGVRAGR
Download sequence
Identical sequences G3QRB9
ENSGGOP00000005162 ENSGGOP00000005162

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]