SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for ENSGGOP00000005208 from Gorilla gorilla 76_3.1

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSGGOP00000005208
Domain Number 1 Region: 156-207
Classification Level Classification E-value
Superfamily SNARE fusion complex 0.000000000277
Family SNARE fusion complex 0.002
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Molecular Function IC (bits) H-Score
Cellular Component IC (bits) H-Score
Biological Process IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSGGOP00000005208   Gene: ENSGGOG00000005321   Transcript: ENSGGOT00000005344
Sequence length 210
Comment pep:known_by_projection chromosome:gorGor3.1:14:5775649:6036755:-1 gene:ENSGGOG00000005321 transcript:ENSGGOT00000005344 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
MSAKSAISKEIFAPLDERMLGAVQVKRRTKKKIPFLATGGQGEYLTYICLSVTNKKPTQA
SITKVKQFEGSTSFVRRSQWMLEQLRQVNGIDPNGDSAEFDLLFENAFDQWVASTASEKC
TFFQILHHTCQRYLTDRKPEFINCQSKIMGGNSILHSAADSVTSAVQKASQALNERGERL
GRAEEKTEDLKNSAQQFAETAHKLAMKHKC
Download sequence
Identical sequences A0A096NXD7 A0A0D9RTF8 A0A2I3H2D9 A0A2J8TQZ4 A0A2K5D0E8 A0A2K5JJN5 A0A2K5KP98 A0A2K5PYJ9 A0A2K6CLS1 A0A2K6KJP5 A0A2K6QTB1 A0A2K6SVN4 F6QBX6 G3QRF6 G7PA03 H2Q842 Q8NFX7 U3BGD1
ENSGGOP00000005208 NP_001247854.1.72884 NP_001291405.1.87134 NP_001291405.1.92137 NP_001291406.1.87134 NP_001291406.1.92137 NP_054897.4.87134 NP_054897.4.92137 XP_004055085.1.27298 XP_005561057.2.63531 XP_005561058.2.63531 XP_005561059.2.63531 XP_005561060.1.63531 XP_007984547.1.81039 XP_007984548.1.81039 XP_007984550.1.81039 XP_008959536.1.60992 XP_008959537.1.60992 XP_008959538.1.60992 XP_008959540.1.60992 XP_009425882.1.37143 XP_009425883.1.37143 XP_009425885.1.37143 XP_009425886.1.37143 XP_010333282.1.74449 XP_010361996.1.97406 XP_011733074.1.29376 XP_011733075.1.29376 XP_011733076.1.29376 XP_011733077.1.29376 XP_011733078.1.29376 XP_011946520.1.92194 XP_011946522.1.92194 XP_012353689.1.23891 XP_012353690.1.23891 XP_012353691.1.23891 XP_016876720.1.92137 XP_016876724.1.92137 XP_016876725.1.92137 XP_016876726.1.92137 XP_016876727.1.92137 XP_016876728.1.92137 XP_016876729.1.92137 XP_016876730.1.92137 XP_016876731.1.92137 XP_017373243.1.71028 XP_017707360.1.44346 XP_017707362.1.44346 XP_018865778.1.27298 XP_021530570.1.9421 9544.ENSMMUP00000020252 9606.ENSP00000324302 ENSP00000324302 ENSNLEP00000018898 ENSP00000324302 ENSP00000379928 ENSP00000397212 ENSP00000447383 ENSP00000449379 ENSP00000449536 ENSPTRP00000010568 ENSGGOP00000005208 ENSMMUP00000020250 ENSMMUP00000020252 ENSMMUP00000020250 GO.36681 GO.55888 HR2227 ENSNLEP00000018898 ENSPTRP00000010568 ENSP00000324302 ENSP00000379928 ENSP00000397212 ENSP00000447383 ENSP00000449379 ENSP00000449536 gi|21426793|ref|NP_054897.4|

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]