SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for ENSGGOP00000005239 from Gorilla gorilla 76_3.1

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSGGOP00000005239
Domain Number 1 Region: 24-201
Classification Level Classification E-value
Superfamily MHC antigen-recognition domain 4.72e-56
Family MHC antigen-recognition domain 0.00000000807
Further Details:      
 
Domain Number 2 Region: 208-295
Classification Level Classification E-value
Superfamily Immunoglobulin 2.55e-21
Family C1 set domains (antibody constant domain-like) 0.00000427
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Biological Process IC (bits) H-Score
Cellular Component IC (bits) H-Score
Molecular Function IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSGGOP00000005239   Gene: ENSGGOG00000005349   Transcript: ENSGGOT00000005375
Sequence length 333
Comment pep:known_by_projection chromosome:gorGor3.1:1:137331281:137334867:-1 gene:ENSGGOG00000005349 transcript:ENSGGOT00000005375 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
MLLLPFQLLAVLFPAGNSEHAFQGPTSFHVIQTSSFTNSTWAQTQGSGWLDDLQIHGWDS
DSGTAIFLKPWSKGNFSDKEVAELEEIFRVYIFGFAREVQDFAGDFQMKYPFEIQGIAGC
QLHSGGAIVSFLRGALGGLDFLSVKNASCVPSPEGGSRAQKFCALIIQYQGIMETVRILL
YETCPRYLLGVLNAGKADLQRQVKPEAWLSSGPSPGPGRLQLVCHVSGFYPKPVWVMWMR
GEQEQQGTQLGDILPNANWTWYLRATLDVADGEAAGLSCRVKHSSLEGQDIILYWRNPTS
IGSIVLAIVVPSLLLLLCLALWYMRHRSYQNIP
Download sequence
Identical sequences G3QRI4
XP_004027073.1.27298 ENSGGOP00000005239 ENSGGOP00000005239

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]