SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for ENSGGOP00000005281 from Gorilla gorilla 76_3.1

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSGGOP00000005281
Domain Number 1 Region: 605-681
Classification Level Classification E-value
Superfamily VHP, Villin headpiece domain 9.55e-28
Family VHP, Villin headpiece domain 0.0000197
Further Details:      
 
Domain Number 2 Region: 177-239
Classification Level Classification E-value
Superfamily Glucocorticoid receptor-like (DNA-binding domain) 3.35e-16
Family LIM domain 0.0016
Further Details:      
 
Domain Number 3 Region: 106-144
Classification Level Classification E-value
Superfamily Glucocorticoid receptor-like (DNA-binding domain) 4.87e-16
Family LIM domain 0.0019
Further Details:      
 
Domain Number 4 Region: 49-111
Classification Level Classification E-value
Superfamily Glucocorticoid receptor-like (DNA-binding domain) 0.00000000000000462
Family LIM domain 0.0023
Further Details:      
 
Domain Number 5 Region: 236-269
Classification Level Classification E-value
Superfamily Glucocorticoid receptor-like (DNA-binding domain) 0.000000000000855
Family LIM domain 0.0021
Further Details:      
 
Domain Number 6 Region: 144-176
Classification Level Classification E-value
Superfamily Glucocorticoid receptor-like (DNA-binding domain) 0.0000000506
Family LIM domain 0.0011
Further Details:      
 
Weak hits

Sequence:  ENSGGOP00000005281
Domain Number - Region: 19-47
Classification Level Classification E-value
Superfamily Glucocorticoid receptor-like (DNA-binding domain) 0.000363
Family LIM domain 0.022
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Molecular Function IC (bits) H-Score
Cellular Component IC (bits) H-Score
Biological Process IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSGGOP00000005281   Gene: ENSGGOG00000005384   Transcript: ENSGGOT00000005420
Sequence length 681
Comment pep:known_by_projection chromosome:gorGor3.1:5:132970299:133091917:1 gene:ENSGGOG00000005384 transcript:ENSGGOT00000005420 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
MNTSIPYQQNPYNPRGSSNVIQCYRCGDTCKGEVVRVHHNHFHIRCFTCQVCGCGLAQSG
FFFKNQEYICTQDYQQLYGTRCDSCRDFITGEVISALGRTYHPKCFVCSLCRKPFPIGDK
VTFSGKECVCQTCSQSMASSKPIKIRGPSHCAGCKEEIKHGQSLLALDKQWHVSCFKCQT
CSVILTGEYISKDGVPYCESDYHAQFGIKCETCDRYISGRVLEAGGKHYHPTCARCVRCH
QMFTEGEEMYLTGSEVWHPICKQAARAEKKLKHRRTSETSISPPGSSIGSPNRVICAKVD
NEILNYKDLAALPKVKSIYEVQRPDLISYEPHSRYTSDEMLERCGYGESLGTLSPYSQDI
YENLDLRQRRASSPGYIDSPTYSRQGMSPTFSRSPHHYYRSGPESGRSSPYHSQLDVRSS
TPTSYQAPKHFHIPAGDSNIYRKPPIYKRHGDLSTATKSKTSEDISQTSKYSPIYSPDPY
YASESEYWTYHGSPKVPRARRFSSGGEEDDFDRSMHKLQSGIGRLILKEEMKARSSSYAD
PWTPPRSSTSSREALHTAGYEMSLNGSPRSHYLADSDPLISKSASLPAYRRNGLHRTPSA
DLFHYDSMNAVNWGMREIYPYELLLVTTRGRNRLPKDVDRTRLERHLSQEEFYQVFGMTI
SEFDRLALWKRNELKKQARLF
Download sequence
Identical sequences ENSGGOP00000005281

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]