SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for ENSGGOP00000005314 from Gorilla gorilla 76_3.1

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSGGOP00000005314
Domain Number 1 Region: 194-260
Classification Level Classification E-value
Superfamily TPR-like 0.00000000000000506
Family Tetratricopeptide repeat (TPR) 0.0039
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Biological Process IC (bits) H-Score
Molecular Function IC (bits) H-Score
Cellular Component IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSGGOP00000005314   Gene: ENSGGOG00000005429   Transcript: ENSGGOT00000005455
Sequence length 265
Comment pep:known_by_projection chromosome:gorGor3.1:15:34474542:34540230:-1 gene:ENSGGOG00000005429 transcript:ENSGGOT00000005455 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
VDKEMMQRIREKSILQAQERAKEATEAKAAAKREDQKYALSVMMKIEEEERKKIEDMKEN
ERIKATKELEAWKEYQRKAEEQKEIQREEKLCQKEKQIKEERKKLKYKSLTRNLASRNLA
PKGRNSENIFTEKLKEDSIPAPRSVGSIKINFTPRVFPTALRESQVAEEEEWLHKQAEAR
RAMNTDIAELCDLKEEEKNPEWLKDKGNKLFATENYLAAINAYNLAIRLNNKMPLLYLNR
AACHLKLKNLHKAIEDSSKAGLELL
Download sequence
Identical sequences ENSGGOP00000005314 ENSGGOP00000005314

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]