SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for ENSGGOP00000005326 from Gorilla gorilla 76_3.1

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSGGOP00000005326
Domain Number 1 Region: 35-112
Classification Level Classification E-value
Superfamily EF-hand 0.000000000000245
Family Calmodulin-like 0.017
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Biological Process IC (bits) H-Score
Cellular Component IC (bits) H-Score
Molecular Function IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSGGOP00000005326   Gene: ENSGGOG00000005442   Transcript: ENSGGOT00000005467
Sequence length 438
Comment pep:known_by_projection chromosome:gorGor3.1:5:21368645:21406003:-1 gene:ENSGGOG00000005442 transcript:ENSGGOT00000005467 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
MAVSEIKPKLKLNPLTKVPISHNKRDRDLPGSLQCQLQHKEKKLSASQMAAFQDAYNFFY
KDKTGCIDFHGLMCTVAKLGMNLTKHDVYNELKCADIDRDGKVNFSDFIKVLTDKNLFLK
AVVPEKETCLDLAGNPGILLFEILSRLLETSALPRKSIIEIVSYFQRKFQHTGPGMLWSP
YTMGYGKRTLKPDICTPPSSSMAAFANAARIAIMKEKDLFKFLEELKRCNSGSDSPYSKI
PIFPLFPNVDGVVMGKPFKDMQKLEMLRRKEPLHFFEDYFFHKRDWKTQAANIKSMDPAS
GYSNNILTIDQMLKKKQTCTVASATAIKQHVKRATDTYNLGIALEHRKEMLNLWQKIRGD
LIGIDSRNESFYDTFSTYTWSWNVCQELLSPKDLRLYDAYVNRNSSHNCRSSSSSDTSEC
DTDSGRKRKQKGLKGFQQ
Download sequence
Identical sequences ENSGGOP00000005326

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]