SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for ENSGGOP00000005349 from Gorilla gorilla 76_3.1

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSGGOP00000005349
Domain Number 1 Region: 477-653
Classification Level Classification E-value
Superfamily Ypt/Rab-GAP domain of gyp1p 6.28e-48
Family Ypt/Rab-GAP domain of gyp1p 0.0041
Further Details:      
 
Domain Number 2 Region: 631-735
Classification Level Classification E-value
Superfamily Ypt/Rab-GAP domain of gyp1p 5.75e-17
Family Ypt/Rab-GAP domain of gyp1p 0.029
Further Details:      
 
Domain Number 3 Region: 799-924
Classification Level Classification E-value
Superfamily EF-hand 0.00000097
Family Calmodulin-like 0.025
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Biological Process IC (bits) H-Score
Molecular Function IC (bits) H-Score
Cellular Component IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSGGOP00000005349   Gene: ENSGGOG00000005459   Transcript: ENSGGOT00000005490
Sequence length 1140
Comment pep:known_by_projection chromosome:gorGor3.1:2a:98451730:98600806:-1 gene:ENSGGOG00000005459 transcript:ENSGGOT00000005490 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
MWLKPEEVLLKNALKLWVTQKSSCYFILQRRRGHGEGGGRLTGRLVGALDAVLDSNARVA
PFRILLQVPGSQVYSPIACGATLEEINQHWDWLEQNLLHTLSVFDNKDDIASFVKGKVKA
LIAEETSSRLAEQEEEPEKFREALVKFEARFNFPEAEKLVTYYSCCCWKGRVPRQGWLYL
SINHLCFYSFFLGKELKLVVPWVDIQKLERTSNVFLTDTIRITTQNKERDFSMFLNLDEV
FKVMEQLADVTLRRLLDNEVFDLDPDLQEPSQITKRDLEARAQNEFFRAFFRLPRKEKLH
AVVDCSLWTPFSRCHTAGRMFASDSYICFASREDGCCKIVLPLREVVSIEKMEDTSLLPH
PIIVSIRSKVAFQFIELRDRDSLVEALLARLKQVHANHPVHYDTSAGDDMASLVFHSTSM
CSDHRFGDLEMMSSQNSKESEKEKSPLLHPDALVTAFQQSGSQSPDSRMSREQIKISLWN
DHFVEYGRTVCMFRTEKIRKLVAMGIPESLRGRLWLLFSDAVTDLASHPGYYGNLVEESL
GKCCLVTEEIERDLHRSLPEHPAFQNETGIAALRRVLTAYAHRNPKIGYCQSMNILTSVL
LLYAKEEEAFWLLVAVCERMLPDYFNHRVIGAQVDQSVFEELIKGHLPELAEHMNDLSAL
ASVSLSWFLTLFLSIMPLESAVNVVDCFFYDGIKAIFQLGLAVLEANAEDLCSSKDDGQA
LMILSRFLDHIKNEDSPGPPVGSHHAFFSDDQEPYPVTDISDLIRDSYEKFGDQSVEQIE
HLRYKHRIRVLQGHEDTTKQNVLRVVIPEVSILPEDLEELYDLFKREHMMSCYWEQPRPM
ASRHDPSRPYAEQYRIDARQFAHLFQLVSPWTCGAHTEILAERTFRLLDDNMDQLIEFKA
FVSCLDIMYNGEMNEKIKLLYRLHIPPALTENDRDSQSPLKNPLLSTSRPLVFGKPNGDA
VDYQKQLKQMIKDLAKEKDKTEKELPKMSQREFIQFCKTLYSMFHEDPEENDLYQAIATV
TTLLLQIGEVGQRSSSSGSCSQECGEELRASAPSPEDSVFADTGKTPQDSQAFPEAAEGD
WTVSLEHILASLLTEQSLVNFFEKPRDMKSKLENAKINQYNLKTFEMSHQSQSELKLSNL
Download sequence
Identical sequences XP_004031559.1.27298 ENSGGOP00000005349 ENSGGOP00000005349

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]