SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for ENSGGOP00000005355 from Gorilla gorilla 76_3.1

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSGGOP00000005355
Domain Number 1 Region: 7-197
Classification Level Classification E-value
Superfamily E set domains 1.26e-75
Family Arrestin/Vps26-like 0.000000148
Further Details:      
 
Domain Number 2 Region: 199-414
Classification Level Classification E-value
Superfamily E set domains 2.66e-68
Family Arrestin/Vps26-like 0.0000000262
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Biological Process IC (bits) H-Score
Molecular Function IC (bits) H-Score
Cellular Component IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSGGOP00000005355   Gene: ENSGGOG00000005467   Transcript: ENSGGOT00000005496
Sequence length 430
Comment pep:known_by_projection chromosome:gorGor3.1:17:4811396:4822720:1 gene:ENSGGOG00000005467 transcript:ENSGGOT00000005496 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
MGEKPGTRVFKKSSPNCKLTVYLGKRDFVDHLDKVDPVDGVVLVDPDYLKDRKVFVTLTC
AFRYGREDLDVLGLSFRKDLFIATYQAFPPVPNPPRPPTRLQDRLLRKLGQHAHPFFFTV
RMPLPSEGQGAGAGTVSGVGIPQNLPCSVTLQPGPEDTGKACGVDFEIRAFCAKSLEEKS
HKRNSVRLVIRKVQFAPEKPGPQPSAETTRHFLMSDRSLHLEASLDKELYYHGEPLSVNV
HVTNNSTKTVKKIKVSVRQYADICLFSTAQYKCPVAQLEQDDQVSPSSTFCKVYTITPLL
SDNREKRGLALDGKLKHEDTNLASSTIVKEGANKEVLGILVSYRVKVKLVVSRGGDVSVE
LPFVLMHPKPHDHIPLPRPQSAAPETDVPVDTNLIEFDTNYATDDDIVFEDFARLRLKGM
KDDDYDDQLC
Download sequence
Identical sequences H2QBY1
XP_016786763.1.37143 ENSGGOP00000005355 ENSGGOP00000005355

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]