SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for ENSGGOP00000005356 from Gorilla gorilla 76_3.1

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSGGOP00000005356
Domain Number 1 Region: 50-129
Classification Level Classification E-value
Superfamily HSP20-like chaperones 0.000000628
Family HSP20 0.017
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Molecular Function IC (bits) H-Score
Biological Process IC (bits) H-Score
Cellular Component IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSGGOP00000005356   Gene: ENSGGOG00000005470   Transcript: ENSGGOT00000005497
Sequence length 159
Comment pep:known_by_projection chromosome:gorGor3.1:5:41935330:41935866:-1 gene:ENSGGOG00000005470 transcript:ENSGGOT00000005497 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
MQRVGNTFSNESRVASRCPSVGLAERNRVATMPVRLLRDSPAAQEDNDHARDGFQMKLDA
HGFAPEEVVVQVDGQWLMVTGQQQLDVRDPERVSYRMSQKVHRKMLPSNLSPTAMTCCLT
PSGQLWVRGQCVVLALPEAQTGPSPRLRSLGSKASNLTR
Download sequence
Identical sequences G3QRU3
ENSGGOP00000005356 XP_004041756.1.27298 ENSGGOP00000005356

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]