SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for ENSGGOP00000005376 from Gorilla gorilla 76_3.1

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSGGOP00000005376
Domain Number 1 Region: 287-375
Classification Level Classification E-value
Superfamily Small-conductance potassium channel 1.57e-36
Family Small-conductance potassium channel 0.0000691
Further Details:      
 
Domain Number 2 Region: 189-332
Classification Level Classification E-value
Superfamily Voltage-gated potassium channels 1.2e-24
Family Voltage-gated potassium channels 0.0014
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Cellular Component IC (bits) H-Score
Molecular Function IC (bits) H-Score
Biological Process IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSGGOP00000005376   Gene: ENSGGOG00000005490   Transcript: ENSGGOT00000005517
Sequence length 427
Comment pep:known_by_projection chromosome:gorGor3.1:19:40971866:40986595:-1 gene:ENSGGOG00000005490 transcript:ENSGGOT00000005517 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
MGGDVVLGLGALRRRKRLLEQEKSLAGWALVLAGTGIGLMVLHAEMLWFGGCSWALYLFL
VKCMISISTFLLLCLIVAFHAKEVQLFMTDNGLRDWRVALTGRQAAQIVLELVVCGLHPA
PVRGPPCVQDLGGPLTSPQPWPGFLGQGEALLSLAMLLRLYLVPRAVLLRSGVLLNASYR
SIGALNQVRFRHWFVAKLYMNTHPGRLLLGLTLGLWLTTAWVLSVAERQAVNATGHLSDT
LWLIPITFLTIGYGDVVPGTMWGKIVCLCTGVMGVCCTALLVAVVARKLEFNKAEKHVHN
FMMDIQYTKEMKESAARVLQEAWMFYKHTRKKESHAARRHQRKLLAAINAFRQVRLKHRK
LREQVNSMVDISKMHMILYDLQQNLSSSHRALEKQIDTLAGKLDALTELLSTALGPRQLP
EPSQQST
Download sequence
Identical sequences G3QRW2
XP_004060931.1.27298 ENSGGOP00000005376 ENSGGOP00000005376

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]