SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for ENSGGOP00000005379 from Gorilla gorilla 76_3.1

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSGGOP00000005379
Domain Number 1 Region: 7-373
Classification Level Classification E-value
Superfamily Sialidases 1.51e-112
Family Sialidases (neuraminidases) 0.00000000000127
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Molecular Function IC (bits) H-Score
Cellular Component IC (bits) H-Score
Biological Process IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSGGOP00000005379   Gene: ENSGGOG00000005494   Transcript: ENSGGOT00000005520
Sequence length 380
Comment pep:known_by_projection chromosome:gorGor3.1:2b:122276320:122278687:1 gene:ENSGGOG00000005494 transcript:ENSGGOT00000005520 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
MASLPVLQKESVFQSGAHAYRIPALLYLPGQQTLLAFAEQRASKKDEHAELIVLRRGDYD
APTHQVQWQAQEVVAQARLDGHRSMNPCPLYDAQTGTLFLFFIAIPGQVTEQQQLQTRAN
VTRLCQVTSTDHGRTWSSPRDLTDAAIGPAYQEWSTFAVGPGHCLQLHDRARSLVVPAYA
YRKLHPIQRPSPSAFCFLSHDHGRTWARGHFVAQDTLECQVAEVETGEQRVVTLNARSHL
RARVQAQSTNDGLDFQESQLVKKLVEPPPQGCQGSVISFPSPRSGPGSPAQWLLYTHPTH
SWQRADLGAYLNPRPPAPEAWSEPVLLAKGSCAYSDLQSMGTGPDGSPLFGCLYEANDYE
EIVFLMFTLKQAFPAEYLPQ
Download sequence
Identical sequences G3QRW5
ENSGGOP00000005379 XP_004033423.1.27298 ENSGGOP00000005379

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]