SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for ENSGGOP00000005396 from Gorilla gorilla 76_3.1

Domain architecture


Domain assignment details

(
show help)

No Significant Hits.

Weak hits

Sequence:  ENSGGOP00000005396
Domain Number - Region: 259-279
Classification Level Classification E-value
Superfamily CCCH zinc finger 0.0628
Family CCCH zinc finger 0.0069
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Molecular Function IC (bits) H-Score
Cellular Component IC (bits) H-Score
Biological Process IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSGGOP00000005396   Gene: ENSGGOG00000005511   Transcript: ENSGGOT00000005538
Sequence length 527
Comment pep:known_by_projection chromosome:gorGor3.1:6:150424613:150460096:-1 gene:ENSGGOG00000005511 transcript:ENSGGOT00000005538 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
MEHPSKMEFFQKLGYDREDVLRVLGKLGEGALVNDVLQELIRTGSRPGALEHPAAPRLVP
RGSCGVPDSAQRGPGTALEEDFGTLASSLRPIVIDGSNVAMSHGNKETFSCRGIKLAVDW
FRDRGHTYIKVFVPSWRKDPPRADTPIREQHVLAELERQAVLVYTPSRKVHGKRLVCYDD
RYIVKVAYEQDGVIVSNDNYRDLQSENPEWKWFIEQRLLMFSFVNDRFMPPDDPLGRHGP
SLSNFLSRKPKPPEPSWQHCPYGKKCTYGIKCKFYHPERPHHAQLAVADELRAKTGARPG
AGAEEQRPPRAPGGSAGARAAPREPFAHNLPPARGSPDLAALRGSFSRLAFSDDLGPLGP
PLPGPACSLTPRLGGPDWVSAGGRVPGPLSLPSPESQFSPGDLPPPPGLQLQPRGEHRPR
DLHGDLLSPRRPPDDPWARPPRSDRFPGRSAWAEPAWGDGATGGLSVYAAEDHEGDARAR
ARIALYSVFPRDQVDRVMAAFPELSDLARLILLVQRSQSAGAPLGKP
Download sequence
Identical sequences G3QRX9
ENSGGOP00000005396 ENSGGOP00000005396 XP_004044860.1.27298

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]