SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for ENSGGOP00000005402 from Gorilla gorilla 76_3.1

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSGGOP00000005402
Domain Number 1 Region: 231-305
Classification Level Classification E-value
Superfamily Homeodomain-like 1.63e-26
Family Homeodomain 0.00072
Further Details:      
 
Weak hits

Sequence:  ENSGGOP00000005402
Domain Number - Region: 56-66
Classification Level Classification E-value
Superfamily Formin homology 2 domain (FH2 domain) 0.00837
Family Formin homology 2 domain (FH2 domain) 0.13
Further Details:      
 
Domain Number - Region: 30-84
Classification Level Classification E-value
Superfamily beta-sandwich domain of Sec23/24 0.0889
Family beta-sandwich domain of Sec23/24 0.038
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Molecular Function IC (bits) H-Score
Biological Process IC (bits) H-Score
Cellular Component IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSGGOP00000005402   Gene: ENSGGOG00000005520   Transcript: ENSGGOT00000005544
Sequence length 348
Comment pep:known_by_projection chromosome:gorGor3.1:2b:125502277:125504622:-1 gene:ENSGGOG00000005520 transcript:ENSGGOT00000005544 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
MSAAFPPSLMMMQRPLGSSTAFSIDSLIGSPPQPSPGHFVYTGYPMFMPYRPVVLPPPPP
PPPALPQAALQPALPPAHPHHQIPSLPTGFCSSLAQGMALTSTLMATLPGGFSASPQHQE
AAAARKFAPQPLPGGGNFDKAEALQADAEDGKGFLAKEGSLLAFSAAEAVQASLVGAVRG
QGKDESKVEDDPKGKEESFSLESDVDYSSDDNLTGQAAHKEEDPGHALEETPPSSGAAGS
TTSTGKNRRRRTAFTSEQLLELEKEFHCKKYLSLTERSQIAHALKLSEVQVKIWFQNRRA
KWKRVKAGNANSKTGEPSRNPKIVVPIPVHVSRFAIRSQHQQLEQARP
Download sequence
Identical sequences A0A096N887 A0A2K5M8U4 A0A2K5RJ34 A0A2K5UYD4 A0A2K6CRE5 G1RI92 H2QJN8
XP_001082998.1.72884 XP_003277528.1.23891 XP_004033454.1.27298 XP_005574763.1.63531 XP_011726281.1.29376 XP_011899336.1.92194 XP_017393223.1.71028 XP_526072.2.37143 ENSGGOP00000005402 ENSGGOP00000018628 ENSPANP00000008813 ENSPTRP00000022357 ENSNLEP00000012948 ENSPTRP00000022357 ENSMMUP00000007770 ENSNLEP00000012948 ENSMMUP00000007770 9544.ENSMMUP00000007770 9598.ENSPTRP00000022357

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]