SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for ENSGGOP00000005404 from Gorilla gorilla 76_3.1

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSGGOP00000005404
Domain Number 1 Region: 233-375
Classification Level Classification E-value
Superfamily Ankyrin repeat 5.27e-18
Family Ankyrin repeat 0.00086
Further Details:      
 
Domain Number 2 Region: 427-469
Classification Level Classification E-value
Superfamily SOCS box-like 0.0000000144
Family SOCS box-like 0.0047
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Cellular Component IC (bits) H-Score
Molecular Function IC (bits) H-Score
Biological Process IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSGGOP00000005404   Gene: ENSGGOG00000005521   Transcript: ENSGGOT00000005546
Sequence length 474
Comment pep:known_by_projection chromosome:gorGor3.1:2b:125532699:125631902:-1 gene:ENSGGOG00000005521 transcript:ENSGGOT00000005546 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
MSNSDYLPDYPLNSDLVKRLKSALDAKDEERVRDLICTEVTPVDAVIELANDDWMKDPSA
QLPTGMLLGDLDHLKPLMDQFFQDANVVFEINKDEMEWQVKSPATFGLSAVWTIYFLRWV
TFDFLVFSLHFHFSCKHLLGRGSGGAAETGGSRWVRQERWDCVGHHVQRGNLEGASRGHG
GITRQGVLSAPYLVSRQGERWGCWQAHLIRTGKALSRYHAPGGSRRKTPLGKTAGSHGLD
EHARLYLGRGAHVDARNGRGETALSAACGAARRPDEHGRCLRLCALLLRRGAEADARDED
ERSPLHKACGHASHSLARLLLRHGADAGALDYGGASPLGRVLQTASCALQASPQRTVQAL
LNHGSPTVWPDAFPKVLKTCASVPAVIEVLFNSYPQLCVSESWKEVIPEEVFQMHKLFYQ
SLFALALTPRCLQHLCRCALRRLFGKRCFDLIPLLPLPKPLQNYLLLEPQGVLH
Download sequence
Identical sequences ENSGGOP00000005404 ENSGGOP00000005404

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]