SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for ENSGGOP00000005405 from Gorilla gorilla 76_3.1

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSGGOP00000005405
Domain Number 1 Region: 39-284
Classification Level Classification E-value
Superfamily Class II aaRS and biotin synthetases 1.62e-88
Family Class II aminoacyl-tRNA synthetase (aaRS)-like, catalytic domain 0.000000354
Further Details:      
 
Domain Number 2 Region: 285-493
Classification Level Classification E-value
Superfamily Putative anticodon-binding domain of alanyl-tRNA synthetase (AlaRS) 2.09e-44
Family Putative anticodon-binding domain of alanyl-tRNA synthetase (AlaRS) 0.00012
Further Details:      
 
Domain Number 3 Region: 620-796
Classification Level Classification E-value
Superfamily ThrRS/AlaRS common domain 1.83e-32
Family AlaX-like 0.037
Further Details:      
 
Domain Number 4 Region: 545-620
Classification Level Classification E-value
Superfamily Translation proteins 0.00000000000459
Family AlaX-M N-terminal domain-like 0.0082
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Molecular Function IC (bits) H-Score
Biological Process IC (bits) H-Score
Cellular Component IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSGGOP00000005405   Gene: ENSGGOG00000005517   Transcript: ENSGGOT00000005547
Sequence length 985
Comment pep:known_by_projection chromosome:gorGor3.1:6:45631293:45645079:-1 gene:ENSGGOG00000005517 transcript:ENSGGOT00000005547 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
MAASVAATARRLRRAIRRSPAWRGLSHRPLSSEPPAAKASAVRAAFLNFFRDRHGHRLVP
SASVRPRGDPSLLFVNAGMNQFKPIFLGTVDPRSEMAGFRRVANSQKCVRAGGHHNDLED
VGRDLSHHTFFEMLGNWAFGGEYFKEEACNMAWELLTQVYGIPEERLWVSYFDGDPKAGL
DPDLETRDIWLSLGVPASRVLSFGPQENFWEMGDTGPCGPCTEIHYDLAGGVGAPQLIEL
WNLVFMQHNRETDGSLQPLPQRHVDTGMGLERLVAVLQGKHSTYDTDLFSPLLNAIQQGC
RAPPYLGRVGVADEGRTDTAYRVVADHIRTLSVCISDGVFPGMSGPPLVLRRILRRAVRF
SMEILKAPPGFLGSLVPIVVETLGDAYPELQRNSAQIANLVSEDEAAFLASLERGRRIID
RTLRTLGPSDMFPAEVAWSLSLCGDLGLPLDMVELMLEEKGVQLDSAGLERLAQEEAQHR
ARQAEPVQKQGLWLDVHALGELQRQGVPPTDDSPKYNYSLRPSGSYEFGTCEAQVLQLYT
EDGTAVASVGKGQRCGLLLDRTNFYAEQGGQASDRGYLVRAGQEDVLFPVARAQVCGGFI
LHEAVAPECLQIGDQVQLHVDETWRLGCMAKHTATHLLNWALRQTLGPGTEQQGSHLNPE
QLRLDVTTQTPLTPEQLRAVENTVQEAVGQDEAVYMEEVPLALTAQVPGLRSLDEVYPDP
VRVVSVGVPVAHALDPASQAALQTSVELCCGTHLLRTGAVGDLVIIGDRQLSKGTTRLLA
VTGEQAQQARELGQSLAQEVKAATERLSQGSRDVAEALRLSKDIGRLIEAVETAVMPQWQ
RRELLATVKMLQRRANTAIRKLQMGQAAKKTQELLERHLKGPLIVDTVSAESLSVLVKVV
RQLCEQAPSTSVLLLSPQPMGKVLCACQVAQGAMPTFTAEAWALAVCSHMGGKAWGSRVV
AQGTGSTTDLEAALSIARTYALSQL
Download sequence
Identical sequences G3QRY8
ENSGGOP00000005405 ENSGGOP00000005405 XP_004044161.1.27298

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]