SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for ENSGGOP00000005419 from Gorilla gorilla 76_3.1

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSGGOP00000005419
Domain Number 1 Region: 10-104
Classification Level Classification E-value
Superfamily Ubiquitin-like 3.91e-21
Family Ubiquitin-related 0.0000244
Further Details:      
 
Domain Number 2 Region: 688-698
Classification Level Classification E-value
Superfamily Formin homology 2 domain (FH2 domain) 0.0000392
Family Formin homology 2 domain (FH2 domain) 0.13
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Cellular Component IC (bits) H-Score
Molecular Function IC (bits) H-Score
Biological Process IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSGGOP00000005419   Gene: ENSGGOG00000005529   Transcript: ENSGGOT00000005562
Sequence length 1162
Comment pep:known_by_projection chromosome:gorGor3.1:6:32531809:32545553:-1 gene:ENSGGOG00000005529 transcript:ENSGGOT00000005562 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
MEPNDSTSTVVEEPDSLEVLVKTLDSQTRTFIVGAQMNVKEFKEHIAASVSIPSEKQRLI
YQGRVLQDDKKLQEYNVGGKVIHLVERAPPQTHLPSGASSGTGSASATHGGGPPPGTRGP
GASVHDRNANSYVMVGTFNLPSDGSAVDVHINMEQAPIQSEPRVRLVMAQHMIRDIQTLL
SRMECRGGPQPQHSQPPPQPPAVTPEPVALSSQTSEPVESEAPPREPMEAEEVEERAPAQ
NPELTPGPASAGPTPAPETNAPNHPSPAEYVEVLQELQRLESRLQPFLQRYYEVLGAAAT
TDYNNNHEGREEDQRLINLVGESLRLLGNTFVALSDLRCNLACTPPRHLHVVRPMSHYTT
PMVLQQAAIPIQINVGTTVTMTGNGTRPPPTPNAEASPPGPGQASSVAPSSTNVESSAEG
APPPGPAPPPATSHPRVIRISHQSVEPVVMMHMNIQDSGTQPGGVPSAPTGPLGPSGHGQ
TLGSTLIQLPSLPPEFMHAVAHQITHQAMVAAVASAAAGQQVPGFPTAPTRVVIARPTPP
QARPSHPGGPPVSGTLQGAGLGTNASLAQMVSGLVGQLLMQPVLVAQGTPGMAPPPAPAT
ASASAGTTNTATTAGPAPGGPAQPPPAPQPSTADLQFSQLLGNLLGPAGPGAGGPGVASP
TITVAMPGVPAFLQGMTDFLQATQTAPPPPPPPPPPPPAPEQQTMPPPGSPSGGAGSPGG
LGLESLSPEFFTSVVQGVLSSLLGSLGARAGSSESIAAFIQRLSGSSNIFEPGADGALGF
FGALLSLLCQNFSMVDVVMLLHGHFQPLQRLQPQLRSFFHQHYLGGQEPTPSNIRMATHT
LITGLEEYVRESFSLVQVQPGVDIIRTNLEFLQEQFNSIAAHVLHCTDSGFGARLLELCN
QGLFECLALNLHCLGGQQMELAAVINGRIRRMSRGVNPSLVSWLTTMMGLRLQVVLEHMP
VGPDAILRYVRRVGDPPQPLPEEPMEVQGAERASPEPQRENASPAPGTTAEEAMSRGPPP
APEGGSRDEQDGASAETEPWAAAVPPEWVPIIQQDIQSQRKVKPQPPLSDAYLSGMPAKR
RKTMQGEGPQLLLSEAVSRAAKAAGARPLTSSESLSRDLEAPEVQESYRQQLRSDIQKRL
QEDPNYSPQRFPNAQRAFADDP
Download sequence
Identical sequences A0A2I2ZNR6
ENSGGOP00000005419 XP_018884601.1.27298 XP_018884602.1.27298 XP_018884603.1.27298 XP_018884604.1.27298 XP_018884605.1.27298 XP_018884606.1.27298 XP_018884607.1.27298 ENSGGOP00000005419

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]