SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for ENSGGOP00000005454 from Gorilla gorilla 76_3.1

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSGGOP00000005454
Domain Number 1 Region: 402-487
Classification Level Classification E-value
Superfamily Surp module (SWAP domain) 2.35e-25
Family Surp module (SWAP domain) 0.001
Further Details:      
 
Domain Number 2 Region: 266-355
Classification Level Classification E-value
Superfamily RNA-binding domain, RBD 7.93e-21
Family Canonical RBD 0.004
Further Details:      
 
Domain Number 3 Region: 538-674
Classification Level Classification E-value
Superfamily ENTH/VHS domain 0.000000471
Family RPR domain (SMART 00582 ) 0.04
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Molecular Function IC (bits) H-Score
Biological Process IC (bits) H-Score
Cellular Component IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSGGOP00000005454   Gene: ENSGGOG00000005563   Transcript: ENSGGOT00000005598
Sequence length 1027
Comment pep:known_by_projection chromosome:gorGor3.1:3:143330440:143390806:1 gene:ENSGGOG00000005563 transcript:ENSGGOT00000005598 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
MADKTPGGSQKASSKTRSSDVHSSGSSDAHMDASGPSDSDMPSRTRPKSPRKHNYRNESA
RESLCDSPHQNLSRPLLENKLKAFSIGKMSTAKRTLSKKEQEELKKKEDEKAAAEIYEEF
LAAFEGSDGNKVKTFVRGGVVNAAKEEHETDEKRGKIYKPSSRFADQKNPPNQSSNERPP
SLLVIETKKPPLKKGEKEKKKSNLELFKEELKQIQEERDERHKTKGRLSRFEPPQSDSDG
QRRSMDAPSRRNRSSGVLDDYAPGSHDVGDPSTTNLYLGNINPQMNEEMLCQEFGRFGPL
ASVKIMWPRTDEERARERNCGFVAFMNRRDAERALKNLNGKMIMSFEMKLGWGKAVPIPP
HPIYIPPSMMEHTLPPPPSGLPFNAQPRERLKNPNAPMLPPPKNKEDFEKTLSQAIVKVV
IPTERNLLALIHRMIEFVVREGPMFEAMIMNREINNPMFRFLFENQTPAHVYYRWKLYSI
LQGDSPTKWRTEDFRMFKNGSFWRPPPLNPYLHGMSEEQETEAFVEEPSKKGALKEEQRD
KLEEILRGLTPRKNDIGDAMVFCLNNAEAAEEIVDCITESLSILKTPLPKKIARLYLVSD
VLYNSSAKVANASYYRKFFETKLCQIFSDLNATYRTIQGHLQSENFKQRVMTCFRAWEDW
AIYPEPFLIKLQNIFLGLVNIIEEKETEDVPDDLDGAPIEEELDGAPLEDVDGIPIDATP
IDDLDGVPIKSLDDDLDGVPLDATEDSKKNEPIFKVAPSKWEAVDESELEAQAVTTSKWE
LFDQHEESEEEENQNQEEESEDEEDTQSSKSEEHHLYSNPIKEEMTESKFSKYSEMSEEK
RAKLREIELKVMKFQDELESGKRPKKPGQSFQVEHYRDKLLQREKEKELERERERDKKDK
EKLESRSKDKKEKDECTPTRKERKRRHSTSPSPSRSSSGRRVKSPSPKSERSERSERSHK
ESSRSRSSHKDSPRDVSKKAKRSPSGSRTPKRSRRSRSRSPKKSGKKSRSQSRSPHRSHK
KSKKNKH
Download sequence
Identical sequences ENSGGOP00000005454

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]