SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for ENSGGOP00000005489 from Gorilla gorilla 76_3.1

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSGGOP00000005489
Domain Number 1 Region: 219-460
Classification Level Classification E-value
Superfamily Nuclear receptor ligand-binding domain 1.57e-70
Family Nuclear receptor ligand-binding domain 0.00000000043
Further Details:      
 
Domain Number 2 Region: 85-173
Classification Level Classification E-value
Superfamily Glucocorticoid receptor-like (DNA-binding domain) 7.44e-26
Family Nuclear receptor 0.0001
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Cellular Component IC (bits) H-Score
Biological Process IC (bits) H-Score
Molecular Function IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSGGOP00000005489   Gene: ENSGGOG00000005607   Transcript: ENSGGOT00000005633
Sequence length 461
Comment pep:known_by_projection chromosome:gorGor3.1:19:47724774:47731415:1 gene:ENSGGOG00000005607 transcript:ENSGGOT00000005633 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
MSSPTTSSLDTPLPGNGPPQPGAPSSSPTVKEEGPEPWPGGPDPDVPGTDEASSACSTDW
VIPDPEEEPERKRKKGPAPKMLGHELCRVCGDKASGFHYNVLSCEGCKGFFRRSVVRGGA
RRYACRGGGTCQMDAFMRRKCQQCRLRKCKEAGMREQCVLSEEQIRKKKIRKQQQQESQS
QSQSPVGPQGSSSSASGPGASPGGSEAGSQGSGEGEGVQLTAAQELMIQQLVAAQLQCNK
RSFSDQPKVTPWPLGADPQSRDARQQRFAHFTELAIISVQEIVDFAKQVPGFLQLGREDQ
IALLKASTIEIMLLETARRYNHETECITFLKDFTYSKDDFHRAGLQVEFINPIFEFSRAM
RRLGLDDAEYALLIAINIFSADRPNVQEPGRVEALQQPYVEALLSYTRIKRPQDQLRFPR
MLMKLVSLRTLSSVHSEQVFALRLQDKKLPPLLSEIWDVHE
Download sequence
Identical sequences F1D8P7 G3QS62 K7BSQ5
NP_009052.3.87134 NP_009052.3.92137 XP_003813668.1.60992 XP_004061275.1.27298 XP_008964388.1.60992 XP_016792139.1.37143 ENSGGOP00000005489 gi|85362735|ref|NP_009052.3| ENSGGOP00000005489

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]