SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for ENSGGOP00000005544 from Gorilla gorilla 76_3.1

Domain architecture


Domain assignment details

(
show help)

No Significant Hits.

Weak hits

Sequence:  ENSGGOP00000005544
Domain Number - Region: 134-186
Classification Level Classification E-value
Superfamily NTF2-like 0.00123
Family TIM44-like 0.081
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Molecular Function IC (bits) H-Score
Cellular Component IC (bits) H-Score
Biological Process IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSGGOP00000005544   Gene: ENSGGOG00000005661   Transcript: ENSGGOT00000005688
Sequence length 291
Comment pep:known_by_projection chromosome:gorGor3.1:2b:88371510:88380302:1 gene:ENSGGOG00000005661 transcript:ENSGGOT00000005688 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
MALAARLLPQFLHSRSLPCGAVRLRTPAVAEVRLPSATLCYFCRCRLGSGAALFPRSARA
LATSALPAQGSRWPVLSSPGLPAAFASFPACPQRSYSTEEKPQQHQKTKMIVLGFSNPIN
WVRTRIKAFLIWAYFDKEFSITEFSEGAKQAFAHVSKLLSQCKFDLLEELVAKEVLHALK
EKVTSLPDNHKNALAANIDEIVFTSTGDISIYYDEKGRKFVNILMCFWYLTSANIPSETL
RGASVFQVKLGNQNVETKQLLSASYEFQREFTQGVKPDWTIARIEHSKLLE
Download sequence
Identical sequences G3QSB2
ENSGGOP00000005544 XP_018878291.1.27298 ENSGGOP00000005544

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]