SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for ENSGGOP00000005573 from Gorilla gorilla 76_3.1

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSGGOP00000005573
Domain Number 1 Region: 296-555
Classification Level Classification E-value
Superfamily Metalloproteases ("zincins"), catalytic domain 1.03e-85
Family Leukotriene A4 hydrolase catalytic domain 0.0011
Further Details:      
 
Domain Number 2 Region: 68-286
Classification Level Classification E-value
Superfamily Leukotriene A4 hydrolase N-terminal domain 3.79e-52
Family Leukotriene A4 hydrolase N-terminal domain 0.0015
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Molecular Function IC (bits) H-Score
Cellular Component IC (bits) H-Score
Biological Process IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSGGOP00000005573   Gene: ENSGGOG00000005686   Transcript: ENSGGOT00000005718
Sequence length 967
Comment pep:known_by_projection chromosome:gorGor3.1:15:69587920:69618748:-1 gene:ENSGGOG00000005686 transcript:ENSGGOT00000005718 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
MAKGFYISKSLGILGILLGVAAVCTIIALSVVYSQEKNKNANSSPVASTTPSASATTNPA
SATTLDQSKAWNRYRLPSTLKPDSYQVTLRPYLTPNDRGLYVFKGSSTVRFTCKEATDVI
IIHSKKLNYTLSQGHRVVLRGVGGSQPPDIDRTELVEPTEYLVVHLKGSLVKDSQYEMDS
EFEGELADDLAGFYRSEYMEGNVRKVVATTQMQAADARKSFPCFDEPAMKAEFNITLIHP
KDLTALSNMLPKGPSTPLPEDPNWSVTEFHTTPKMSTYLLAFIVSEFDYVEKQASNGVLI
RIWARPSAIAAGHGDYALNVTGPILNFFAGHYDTPYPLPKSDQIGLPDFNAGAMENWGLV
TYRENSLLFDPLSSSSSNKERVVTVIAHELAHQWFGNLVTIEWWNDLWLNEGFASYVEYL
GADYAEPTWNFKDLMVLNDVYSVMAVDALASSHPLSTPASEINTPAQISELFDTISYSKG
ASVLRMLSSFLSEDVFKQGLASYLHTFAYQNTIYLNLWDHLQEAVNNRSIQLPTTVHDIM
NRWTLQMGFPVITVDTSTGTLSQEHFLLDPDSNVTRPSEFNYVWIVPITSIRDGRQQQDY
WLMDVRAQNNLFSTSSNEWVLLNLNVTGYYQVNYDEENWRKIQTQLQTDHSAIPVINRAQ
IINDAFNLARAHKVPVTLALNNTLFLIEEREYMPWESALSSLSYFKLMFDRSEVYGPMKN
YLKKQVTPLFIHFRNNTNNWREIPENLMDQYNEVNAISTACSNGVPECEEMVSGLFRQWM
ENPNNNPIHPNLRSTVYCNAIAQGGEEEWDFAWEQFRNATLVNEADKLRAALACSRELWI
LNRYLSYTLNPDLIRKQDATSTIISITNNVIGQGLVWDFVQSNWKKLFNDYGGSSFSFSN
LIQAVTRRFSTEYELQQLEQFKKDNEETGFGSGTRALEQALEKTKANIKWVKENKEVVLQ
WFTENSK
Download sequence
Identical sequences G3QSE0
XP_018866310.1.27298 ENSGGOP00000005573 ENSGGOP00000005573

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]