SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for ENSGGOP00000005601 from Gorilla gorilla 76_3.1

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSGGOP00000005601
Domain Number 1 Region: 526-604
Classification Level Classification E-value
Superfamily PDZ domain-like 3.15e-21
Family PDZ domain 0.0042
Further Details:      
 
Domain Number 2 Region: 16-93
Classification Level Classification E-value
Superfamily HR1 repeat 3.66e-21
Family HR1 repeat 0.0021
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Biological Process IC (bits) H-Score
Molecular Function IC (bits) H-Score
Cellular Component IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSGGOP00000005601   Gene: ENSGGOG00000005716   Transcript: ENSGGOT00000005746
Sequence length 694
Comment pep:known_by_projection chromosome:gorGor3.1:8:143544227:143558595:1 gene:ENSGGOG00000005716 transcript:ENSGGOT00000005746 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
MILEERPDGAGAGEESPRLQGCDSLTQIQCGQLQSRRAQIHQQIDKELQMRTGAENLYRA
TSNNWVRETVALELSYVNSNLQLLKEELEELSGGVDPGRHGSEAVTVPMIPLGLKETKEL
DWSTPLKELISVHFGEDGASYEAEIGELEALRQAMRTPSRNESGLELLTAYYNQLCFLDA
RFLTPARSLGLFFHWYDSLTGVPAQQRALAFEKGSVLFNIGALHTQIGARQDRSCAEGAR
RAMEAFQRAAGAFSLLRENFSHAPSPDMSAASLCALEQLMMAQAQECVFEGLSPPASMAP
QDCLAQLRLAQEAAQVAAEYRLVHRTMAQPPVHDYVPVSWTALVHVKAEYFRSLAHYHVA
MALCDGSRECPPHLPMVLPRPPHGSQPLCPPAATEGELPTHEQVFLQPPTSSKPRGPVLP
QELEERRQLGKAHLKRAILGQEEALRLHALCRVLREVDLLRAVISQTLQRSLAKYAELDR
EDDFCEAAEAPDIQPKTHQKPEARMPRLSQGRGPDIFHRLGPLSVFSAKNRWRLVGPVHL
TRGEGGFGLTLRGDSPVLIAAVIPGSQAAAAGLKEGDYIVSVNGQPCRWWRHAEVVTELK
AAGEAGASLQVVSLLPSSRLPSLGDRRPVLLGPRGLLRSQREHGCKTPASTGASPRPLLN
WSRKAQQGKTGGCPQPCAPVKPAPPSSSKHPVWP
Download sequence
Identical sequences ENSGGOP00000017166 ENSGGOP00000005601

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]